KEGG   Loa loa (eye worm): LOAG_01625Help
Entry
LOAG_01625        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
loa  Loa loa (eye worm)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LOAG_01625
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    LOAG_01625
   04070 Phosphatidylinositol signaling system
    LOAG_01625
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LOAG_01625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1875 aa AA seqDB search
MTASVVGRLVNAIHSNAAPPKPNSLLVFVCKLASTHPSGSGAHGFIIDDGTIALFQPELE
KLRHILHFPEELAFQLSATEYQLFYEIQPMDYVHYVSCDLTSVPVAENPSPIRNLIKRLS
EISSWITHLIISMPTSEERKTILTSIFRMIDTCWNIGNFNAAVEILVGLKSEKLRSFWLS
LKPEEKKKYEQLCDVLLPSNQTALSTTYREAIQRGLRMPQCKLIPFFGVFLRDLYAIVND
MPSVVMTVDADDKDELEFMKEQTDDSCCASEIGVSGLLNADKISLVAVVLDNLELFYHHY
KNIPCFVVDPAGPSIGKENPKPKGYDPVEPVKGIVRNATLVPLDTNRFDLDVIQRLHHGT
TVIHCDPYAGRSALCMLKLDATCGLLSWCKVGYLGTKEIKDKNAYIPSVARMQSAKPQSM
TPLESRNPPSSPSFRPAGAACTALEYGFLNLSYVKSIENIDSHDIDIESIYRRHSNDEMS
VQMHCWRINFGCYLSDNEFLYFIAPEKSAQCWITGLTTIVNYLLEQQKCADRRVLWLKKL
YLQLCTNCEHDSVMDEGIISSLRPYKALQAFGGQTEGWEDSGLQSFVTKPLQSGTIRSAE
VTVGKGCLKQMTNAVTRRMKFVSRGSAHPQSPESMKAQCQSLRNCISGQQWTISDPNVPK
AISKKRDSSSSTDTASLPSWYKSRRLSARALASFWFGKIKKTKGLEDASESPTVYKEFLV
SSKSYEGGYSEKPVTLFEFIELYKLFCANMRTDLKDIFNDFLVMSGGGNGGVAKHERNPN
FVLMEPSLSDTEFIPNDILTRNTLTTQNIDGKQQKVYNALALASLNSTVLTNASFLTPTM
LKQFLAIHQMEIVDEDYAMKIIQEHEPDPAHRSNQQLSFGGFVRYMTDPTNYAFVPEVIK
PDQDMLHYPLNYYYICSSHNTYLTGHQLKGESSTEMYRQVLLTGCRCVELDCWDGENGLP
LIFHGHTLTSKIGFREVLSVIKKSAFTTSNLPLVLSIENHCSLQQQARMAQMFKNYLGEK
LVTYFLFEADYSNSPRLPSPWQLQNKILIKNKKMIAEPSAGLRMDKYFARNGGDPILEQT
DGFYGIDEDDFEEFYDDLDDEEADSESPRVTNRLSKGTPLQSSSEAEEEHKYVVSRLTHV
TSATFDSKTDDELLSVNAERVMQRPIKKIPGPPVAPELSDLVNYMQAAKFKGFPGTVSFF
HRREESVKSSMPRMSGAGSNLLPISTPPRRLRNATLSDGENKWKSSEDTRFSSTSSSKPN
SNASCYQVTSLNESSARKLSRKHPLKFIAYSREQIVRTYPGGMRIDSSNFNPVQYWAFGL
QMVALNFQTTDTAMAVNAAMFEQTGNCGYTLKPRVLWDDSHPYYNRFNPLGKDTTSISAL
LYTVTIISGQHVCPNQHSASTYVEVEIIGIPADCAKEKSKTVSRNSVNPIWKHTSTFRIA
FVYLAFLRISVCDNTSGRCMAQRVVPVRCIRAGYRHLPLRTPTNVPMEQGTIFLYSHFEQ
EEHIYLHDEDSNFNCNTDQQFHPQTLNISPTATVKAVPILKRQIFVLRISGLYNDDTPVI
VHAESFSTVRNVVQMALTNVGKNADTAEEYVLIEVNSNEMLSNSGEQQNMQSGHRILPFK
ELIMNFVACWNGSMRRFVIRKKGMDPSGRAWISSIIKGGVGTPLSLSTIQSPPCAQSPSE
RKANNRSLGQHAVLHRIKSLDRDVFSERKIITDLRPLTRTMNETFLVCVHNVSRDQPYVI
LRPSIYSTANDIIKEVFLKSRQTNVTESEYVLVEETVKETKSAPIRPLKSTVSGNITLFG
EKSAEVAKPFEYKSVSMRVLASNEIVWKAQSAWKTSGRFILENREHTIHSTKEKMRSLLQ
ALENAHMGSSPSISH
NT seq 5628 nt NT seq  +upstreamnt  +downstreamnt
atgacagccagtgttgttggacgacttgtcaacgccatccattcaaatgcagcaccgcca
aaaccaaattctttacttgtattcgtctgcaagttagcttcaacgcatccaagtggttcc
ggagcacatggttttataattgatgatggaacgattgctttatttcaaccggaacttgaa
aaacttcgacatatattgcattttcccgaggaattagcctttcagttatcagcaaccgaa
tatcaattattttatgagatacaaccgatggattatgttcattatgtgagctgcgactta
acttcagtaccagttgcagaaaatccaagtcccattcgaaatcttattaaacgcttgtct
gagataagttcgtggataacccatcttataattagcatgccaacttctgaggaacgaaaa
acaattcttacttccattttccgaatgatcgatacgtgctggaacattggtaatttcaat
gcagctgttgaaattctggtgggattgaaaagtgaaaagttgcgatcattttggttatcg
ttgaaacctgaggaaaagaaaaaatacgaacagctttgtgatgtcctattacccagtaat
cagacagctttatcgactacttatcgagaagcgattcaaagaggtttacgcatgccacag
tgcaagctgattccttttttcggtgtcttcttgcgtgacctatatgctatagtaaacgat
atgccaagcgttgtgatgactgttgatgcagatgataaagacgagcttgagtttatgaaa
gaacaaactgacgacagttgttgtgcgtccgaaattggtgttagtggtttgttaaatgct
gataaaatcagtctagtggctgtggtacttgataatttggaattgttttatcatcattat
aaaaatataccatgttttgttgtggatcctgccggaccaagtattgggaaagaaaatcca
aaacccaagggttatgacccagtggaaccggtaaaaggtattgtaagaaatgctactttg
gtacctctggatacgaatcgttttgatctggatgtaatccagcgacttcatcatggtacc
acagtcattcattgtgacccatatgcaggtcgcagcgcactttgtatgctgaaattggat
gccacttgtggcttgttgtcatggtgtaaagttggttatttgggaacgaaggagataaaa
gacaaaaatgcatatatcccatcggtggcacgaatgcaaagcgcaaaaccacaaagtatg
acaccactggagagtcgcaatcctccttcatcaccaagttttcgaccagccggagctgcc
tgtactgcactggaatatggctttttaaatctttcctatgtcaagtccattgaaaatatt
gactcacacgacatcgacattgagagcatttatcgacgccacagcaacgacgaaatgtct
gtgcaaatgcactgttggagaataaattttggttgttatttgtctgacaatgaatttctg
tactttatcgcaccagagaaaagcgcccaatgctggataactgggctaacaactattgta
aactacttactggagcaacagaaatgcgcagatcgacgagtcctatggcttaagaagcta
tatttacaactgtgcactaattgcgaacatgatagcgtcatggacgaaggcattatatct
agtctacggccttataaagctctccaagctttcggtggccaaaccgaagggtgggaggat
tcaggtttgcaaagtttcgttacaaaaccacttcaatcgggaacgattcgttctgcagaa
gttacggtgggaaaaggttgtttaaaacaaatgacaaatgcagttacgcgacgaatgaaa
ttcgtaagtcgtggtagtgctcatccacaaagtccagaatcaatgaaggcacagtgccag
tcactacgaaattgcataagtggccaacagtggacgatatcagatccaaatgtaccaaag
gcgatatcgaaaaaacgtgacagttcttcatcaactgatactgctagtcttccctcctgg
tacaaatccagaaggctatcagcaagagcattagcttctttctggtttgggaaaataaaa
aaaacaaaaggtctcgaagacgcaagtgaaagtccaactgtctacaaggagtttttggtg
tcttcgaaatcctatgaaggaggatattcagagaagccagtaacattattcgaatttatt
gaactgtacaaattattttgtgcgaacatgcgaacagatttaaaagacattttcaacgat
ttcctcgtgatgtctggaggtggcaatggaggtgtagctaagcatgaacgaaatccaaac
tttgtactaatggaaccatcgctttcggatactgagtttataccaaacgatatcctcaca
aggaatactttgacaactcagaacattgatggaaagcaacagaaggtgtacaacgcacta
gctcttgctagtttaaatagtacggtcctaacgaatgcatcatttctaactcccacaatg
ctgaaacaatttcttgcaatacatcaaatggaaattgtggatgaagattatgctatgaag
ataatacaggaacacgaaccggatccagctcatcgaagtaatcagcaactttcatttgga
ggatttgtgcgctacatgacagatccaacaaattatgcatttgtgcctgaagtaatcaaa
cctgatcaagatatgcttcattatccgttaaactattactatatttgctcaagtcacaat
acttacctcacaggtcatcagctgaaaggtgaatcatccactgaaatgtatcgccaggtg
ctattgacaggctgtcgctgtgttgaattagattgctgggatggtgaaaacggcttacct
ctaatattccatggtcatactttgacatccaaaattggttttcgtgaagtactcagcgtt
atcaaaaaaagtgctttcactactagcaatttgcctcttgttttgtcaatcgaaaatcat
tgctcacttcagcagcaagcaagaatggcccaaatgtttaaaaattacctcggggaaaaa
cttgttacatattttttgttcgaagctgactatagtaattctccacgacttccatcacca
tggcagttgcagaataaaattttaattaaaaacaagaaaatgatcgcagaaccaagtgct
ggactacgaatggataaatacttcgccagaaatggaggcgatccaattctggagcagacc
gatggattttatggaatagacgaagatgactttgaagaattttatgatgatctagatgac
gaagaagctgattcggaaagtccgagggtaacaaaccgattatcaaaaggcacgccactt
caatcatccagtgaagctgaggaggagcacaaatacgttgtgtccagattaacgcatgtg
acaagcgcaacattcgactcgaaaacagatgatgaactgttgtccgttaatgcagaaaga
gtgatgcaaagacccattaagaaaataccaggacctccagttgcacctgagttatcggat
ctagtaaattatatgcaagctgcaaaattcaagggttttcctggcacggttagttttttt
catcgacgagaagaatctgtcaaatcctcgatgccgagaatgtctggagcaggttctaat
ttattaccaatatcaactccaccacgacggttacggaatgccacattatctgatggagaa
aataaatggaaatctagcgaggatactcggttttcttctacttcatcgtcgaagcccaat
agtaatgcatcgtgctatcaagttacatcacttaatgaatcatccgcccggaaactttca
aggaaacacccactgaaatttatcgcttattcacgtgagcagattgttagaacgtatcct
ggcggtatgcgcattgattcttccaacttcaatccagtccaatattgggcatttggtttg
caaatggttgctttgaattttcaaaccactgacacagcaatggccgtaaatgcagcaatg
ttcgaacagactgggaattgtggatatactttgaagccgagggttttatgggacgattcc
catccatactataatcgtttcaatccgctcggtaaagatactacttcaatatccgcgttg
ctttatacagttacgataatatcaggacagcatgtatgcccaaaccaacatagcgcttca
acctatgttgaggtggaaatcatcggaataccagcagactgtgccaaagagaagagtaaa
acagtaagccgaaattcagtgaacccaatttggaaacacacctcaacattccggatcgct
tttgtttatctggcttttttgcgaatctctgtctgcgataacacaagtggaagatgtatg
gcacaacgagtggttcctgtgcgctgtattcgggcaggatatcgtcatctcccattacga
acacccaccaatgtaccgatggagcagggaaccatatttttgtattcacattttgaacaa
gaagaacatatctatttgcatgacgaagacagtaatttcaactgtaatactgatcagcag
ttccatcctcagacgctcaatatctctccgacggcaacggtaaaggcagttcccattctc
aaacgacagattttcgttctacgaatatcgggcttatataatgacgatacaccagttatt
gtgcatgctgaatcattcagcacagtgaggaatgtcgtgcaaatggcactcacaaatgtg
ggaaaaaatgcggacacagctgaggaatatgttttgattgaagtaaacagcaatgaaatg
ctgagtaacagtggtgaacagcaaaacatgcaatccgggcatcgtattttaccattcaaa
gaactgatcatgaattttgttgcatgctggaatggttccatgcgacgtttcgtcatcagg
aaaaaaggaatggatcctagcggtagagcttggattagttctataatcaagggtggcgtg
ggaacaccgctgtcactgtcaacgattcagtcaccgccttgcgctcaatctccatcggag
agaaaagcaaataatcgttctttagggcaacacgctgtacttcatagaataaaatctttg
gatcgagatgtttttagcgaaaggaagattataactgatttgcgtccactcacgcgtact
atgaacgaaacttttctggtatgtgttcataacgttagcagagatcaaccatatgttatt
cttcgaccgagtatttacagcacggccaatgatatcatcaaagaagttttcttgaaatca
cgacaaacgaatgtcactgaatcagaatatgtgctggttgaagaaacagtgaaggaaaca
aaatcagctccaattagaccgctgaagtcgaccgtctctggaaacattaccttattcgga
gagaaaagtgctgaggttgcaaaaccttttgagtataaaagcgtctctatgcgagtgctg
gcatcgaatgaaattgtctggaaagcgcaaagtgcatggaaaacatctggacgtttcata
ctggaaaatcgagaacataccattcattcaactaaagaaaaaatgagaagtttgttgcaa
gcactcgagaatgcgcacatgggttcatcaccatccattagtcattaa

DBGET integrated database retrieval system