KEGG   Loa loa (eye worm): LOAG_01915Help
Entry
LOAG_01915        CDS       T02664                                 

Definition
(RefSeq) O-glycosyl hydrolase family 30 protein
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
loa  Loa loa (eye worm)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LOAG_01915
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LOAG_01915
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    LOAG_01915
Enzymes [BR:loa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LOAG_01915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 556 aa AA seqDB search
MKHMYGQSSGRPISMCLVPRPMDIIFICNSRSSSLSVLYLFLLFFCRTLLCSDKEVRKCQ
HRYYEKREDIVCVCNATYCDDVPEVGILQPLQAAIYKTNQRGKRFVRTVSSFMEKANGAG
ELIRLKIDSKIRFQTIIGFGGAFTDAAGINIASLSEPTRTNLLQSYFGNTGIKYTIGRVP
IASTDFSTHPYSYDDSPNDFTLSNFSLAEEDFKFKIPYIKQAVNLTGGILKLFASPWSAP
GWMKTSGLMIGGGALRGPPNGPYHVAWANHYVKFLEAYKNNGVTFWGLTVQNEPVSGVDL
SYKWQTMYFSPKTERDFIKHHLGPVLRRNEVSRNISLMIMDDQRTQLPIWADVVLKDKEA
AQYVSGIAVHWYSDFVPVSQLSETHNRHPNKFIFGTEACTGFKPFEHRPILGDWSRGDMY
AHDIIQDLSHWVSGWTDWNLCLDLRGGPSFVKNYVDAPIIVNATADEFYKQPMFYVMGHF
SKFIPPGSVRIELHFYVKPVSYEGVAFITPAQQRILVLLNRDNKSVTFSVEERTKNGIAL
RIELEPKSIATVVWNK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatatgtatggtcaaagtagtggacggcccatttccatgtgtctggttcctcgt
ccaatggatataatattcatctgtaattctcgaagctcttcactttccgtcctttattta
tttcttctgtttttctgtagaacgcttttgtgctcagacaaagaagtccgaaaatgccaa
catcgatattatgaaaagagggaagatatagtttgtgtgtgcaatgcgacatactgtgat
gatgtaccagaagtgggcatcttacagccgttgcaggcagctatctataaaacgaaccaa
cgtgggaagcgtttcgtacgtactgtctcttcgttcatggaaaaggcaaatggagctggg
gaattgattcgcttaaaaattgatagtaaaatacggttccaaacaataattggatttggc
ggagcattcactgacgcggctggtatcaatatcgcctcgctgagtgaaccaactcgaact
aatctgttgcagtcctattttggaaatacaggtataaaatatacgattggcagagtgccg
attgcaagtactgatttctcaactcatccatattcatatgatgactcaccgaatgatttt
actctcagcaatttctcattggctgaagaggatttcaagttcaagattccttatatcaag
caggcagtaaacttaacaggtggtatactcaaattattcgcttccccatggtcagcacca
ggatggatgaaaactagtgggctaatgattggtggtggagcactacgtggacctcctaat
gggccatatcatgtggcgtgggctaaccactatgtgaaatttcttgaggcatacaaaaac
aatggtgtgacattttggggacttactgttcaaaacgagccggtatccggcgttgatctg
tcatacaagtggcaaacaatgtattttagtcccaaaactgaacgcgattttataaaacat
catcttggtccagttttacggagaaatgaagtgagtcggaatatatcattaatgataatg
gatgatcaaagaacacagctaccgatttgggctgatgtggtccttaaagacaaagaggct
gctcagtacgtatctggcatagcagtgcattggtatagcgatttcgtgccagtgtcacag
ctttctgaaacacacaatcgtcatccaaataaattcatcttcggaactgaggcatgtact
ggattcaaaccgtttgaacacaggccgattctgggagattggtcgcgcggcgatatgtat
gctcatgatattattcaggatctttctcattgggtgtctggatggactgattggaatctc
tgtcttgatttgaggggtggaccaagctttgtcaagaattatgtagatgcaccaataata
gtaaatgcaactgctgatgaattttacaaacaacctatgttttatgttatgggacatttc
agtaaattcattccgccgggttcagtccgaattgaactgcatttttacgtgaagccggtt
tcatatgaaggagttgcattcattactccagcacagcaacggattttggtacttttgaat
cgtgacaataaatcagtgacattttcggtcgaagagagaactaaaaatggtatagccctt
cgcatagaactagaaccgaagagtatcgcaactgttgtttggaataaatag

DBGET integrated database retrieval system