KEGG   Loa loa (eye worm): LOAG_02789Help
Entry
LOAG_02789        CDS       T02664                                 

Definition
phosphatidylinositol-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
loa  Loa loa (eye worm)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LOAG_02789
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    LOAG_02789
   04070 Phosphatidylinositol signaling system
    LOAG_02789
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LOAG_02789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 731 aa AA seqDB search
MCRIKAGRLMTSQNVYVEDQKWLCYHSNVCWKFVPLKLKSINIDNILEVRKGFSSDNLHK
ASKKYSFREKVTAEMCLSVILTHRRMLHKSVDFAAENLSVRDKFVKGLQYLVDKKNQKRV
HFDEERWLLDNFRKADINKDGSLSFDEILKLLKTLNLQISNKYARALYTQADSFGKNDGK
LDEKEFLKFFSHLTDRPDLEHAMRMFSATSDLAFSAFDLKTFLTTEQEFDDIDENKAASI
IDSFESAKQGAKILGPIGFRWLLLGKWGNIMKPGHEGVFQDMDHTLSHYYVSSSHNTYLT
GLQIKGEATVEGYINALKKVDVFDGEEGEPCITHKRTFIRTITLKDVLKEIDAYAFKANP
YPVILTIENHVGLPQQKAMSRIFKEVLGDKIYMRPKNGASQPLPSPNALKNKYLLRGKKL
RSEQGPDRKFDQDSDEIIQDSKESKDTIKLDPEFSELISLPSVKLSRNIFKDIDEHPMDG
SSSLSEGKVANYMESGYSLAAYTSKRFVKSFPKGMRQDSSNMDPIPSWLCGVQSVAMNMQ
TTGEYLDLVNGLFRTNGNCGYVLKSKTLIDGLDPRMPEVSSAVVTTMLVGVISGQYLPMI
SQANDVVDPYVTVEIFGIPADSRKFRTKTIRNNGFNPQFNETFTFPLHFPDFALLRFCVK
DFDSTSANDFVGEYTIPVKSIRAGTRCLVYLDDRKKVHTEPHLGYSHIRLNTGNLRTVDE
CASLFVRIALE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcggatcaaagcgggtcgcttgatgacatctcaaaatgtctacgtggaagatcag
aaatggctgtgctatcattcaaatgtctgttggaagtttgtgccgttgaaactgaagtct
ataaatattgataatattctggaggtgcgaaaaggattcagttctgataaccttcacaaa
gcttccaagaaatattcttttcgagaaaaagttacggcagaaatgtgtttgtctgtaatc
ttaactcatcgacgtatgctccacaaatcggttgattttgctgctgaaaatctatctgtg
agagataaatttgtgaaaggtttgcaatatcttgtcgataagaaaaatcagaaacgcgtg
cattttgatgaagagcgctggcttttggacaatttccgaaaagctgatataaacaaagat
ggcagcttaagttttgatgaaatattgaagctgctgaaaacgctgaatctgcagatcagt
aacaaatatgcacgtgctttgtacacgcaagcagattcttttggcaaaaatgatgggaaa
ctcgacgaaaaagaattccttaagttcttctcccatctaacagaccgtccggatctggaa
catgcaatgaggatgttcagtgcgaccagtgacctagctttttctgctttcgatctgaaa
acatttttaacaaccgaacaagagttcgatgatattgatgaaaataaggctgcatcaatt
atcgacagttttgaatcagcaaagcaaggcgcaaaaatacttggacccataggttttcgt
tggttactgctcggtaaatggggcaacatcatgaagcctgggcatgagggagttttccaa
gacatggatcatacattaagtcattattatgtcagctcaagtcacaatacctatctcact
ggattgcaaataaagggtgaagcaaccgttgaaggttatatcaacgcgctaaaaaaggta
gatgtttttgatggcgaagaaggagagccatgtattacgcacaaacgtacttttatcaga
acgattacgctgaaagatgtattgaaagaaattgatgcgtatgcttttaaagcaaaccct
tatccagtaatactgactatcgagaatcatgttggcttgccgcaacagaaggcaatgtcg
cgcatctttaaagaagtgttaggcgacaaaatatatatgcgcccaaaaaatggagcttct
caacctttaccttctccaaatgctttgaagaataaatatctgttgcgcggcaaaaaattg
agatcagaacaaggtcctgatcgaaaatttgatcaagatagtgacgaaataatccaagat
agcaaggaaagtaaagacaccatcaaactcgacccagaattttctgaactgatatcgctg
ccatctgttaaactttcgcgtaatatcttcaaagatatcgatgaacatccaatggacggt
tcttcttctttatccgaagggaaggttgcaaattatatggaaagcggttattcgcttgcc
gcttatacatcaaaaaggtttgtgaaatcgttcccaaaaggtatgcggcaggattcaagc
aatatggatcccatcccttcatggctttgcggtgtacagtcggtcgcaatgaatatgcag
actactggggaatatctcgatttagttaatggtctctttcgaactaatggtaattgtggt
tacgtgctcaaatcgaagacacttattgatggacttgatccgcgtatgcctgaagtatcg
agtgcagttgtaacaacgatgctggttggggtcataagtgggcaatatttacccatgata
tctcaagcaaacgatgttgtcgatccatatgtgaccgttgagatctttggaattccggcc
gattcccggaaattccgaacaaaaaccatccgcaataatggctttaacccacagttcaac
gaaacttttacatttccgcttcatttccctgattttgcactgctccgtttctgtgttaaa
gacttcgactcaacttcagcaaacgattttgttggtgaatatacaatcccggtaaaaagt
attcgtgcaggaacaagatgcctggtttatcttgatgatcgaaaaaaagtacacacagaa
ccacatttaggctactcacatatacgactgaatacgggcaatttgcgtacagtggacgaa
tgtgcgtcactttttgtacgaatcgcacttgaatga

DBGET integrated database retrieval system