KEGG   Loa loa (eye worm): LOAG_02973Help
Entry
LOAG_02973        CDS       T02664                                 

Definition
CMGC/MAPK/JNK protein kinase
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:loa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOAG_02973
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    LOAG_02973
   04012 ErbB signaling pathway
    LOAG_02973
   04310 Wnt signaling pathway
    LOAG_02973
   04068 FoxO signaling pathway
    LOAG_02973
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_02973
Protein kinases [BR:loa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LOAG_02973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 551 aa AA seqDB search
MGDTVIAVYIMLCLQWLGSSNSGGRDDCETEAISLDSCASVLEPSYLEGVYPTPMASTSA
ASEFYNVDINDTRLCVLKRYQNLRIIGSGAQGVVCAAHDTLRDEQVAIKKLSRPFQNVTH
AKRAYREFKLMNLVNHKNIIGLLNAFTPQKTLDEFSDLYIVMELMDANLCQVIQMDLDHE
RMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAGDSFMMTPYV
VTRYYRAPEVILGMGYKDNVDVWSTGCIFGEMIRGSVLFPGSDHIDQWTKIVEQLGTPSP
MFMRRLQSTVRNYVENRPHFLGFPFDKLFPDELFPASSSSDSRLTVDIWSIGCIFGELIR
GRVLFPGTDHIDQWSKIIEQLGTPGRDFMQKLQATVRSYVENRPRHPGLPFEILFSDNIF
PKPATNSALCPAQARDLLSKMLVIDPEKRISVDEALKHPYVYVWFDEAEVYAPPPEQYNH
SIDSRDHTVEQWKELIFKEIMHYEQTHDEYGIKKSLNCTSAAAPSSSSSSFQNIEHGDCS
TTGSTLVTNGL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgggagatactgtaattgctgtgtacattatgctgtgtttgcagtggctgggaagttcg
aattcaggtggtcgtgacgattgcgagacagaagcgatttcgctcgacagttgcgcaagc
gttttggagccgtcctatcttgaaggcgtttatccaactcccatggcttccacttctgct
gcatccgaattttacaacgttgacatcaatgacacacgtttgtgtgttttgaagcgctat
caaaatttaaggataatcgggtctggtgcacagggtgtcgtatgtgctgcacatgatact
cttcgtgatgagcaagtcgctattaagaagctgagtcgtccgttccaaaatgtgacgcat
gctaaacgagcttacagagagttcaaattgatgaatcttgtcaaccataaaaatataatt
ggattgttgaatgcattcacacctcaaaaaacactcgatgaattttccgatttgtacata
gtaatggaacttatggatgctaatttatgccaagtaatccaaatggacttagatcatgaa
aggatgtcctatttgttgtatcaaatgttatgtggtatcagacacttgcatgctgcgggt
atcatacaccgggatctcaaaccgagcaatattgttgttaaaagtgattgtagtttgaaa
atattggattttggtttagcgcgaagtgccggtgattcatttatgatgacgccatatgtt
gtaacacgttactatcgtgcacctgaagttatactagggatgggatacaaagataatgtt
gatgtttggtcaacgggctgtatattcggcgaaatgattcgtggtagtgtattgtttccg
ggcagtgatcatattgaccagtggaccaaaattgttgagcagcttggtactccttcaccg
atgttcatgcgtcgcttgcaatcaactgtccgaaattatgtggaaaatcggccccatttc
cttggttttccattcgataagctcttcccggatgaattatttccagctagcagcagttct
gactcacgacttactgttgatatatggtcgattggctgtatttttggtgaactcattcgt
ggccgagttcttttccctggtacggatcatattgaccagtggtcaaaaatcattgagcag
ctgggaacacccggacgagattttatgcagaagttgcaagcaactgtgaggagctatgtg
gagaatcgtcctaggcatcccggtcttccatttgagattctctttagtgataatatattt
ccaaagccagcaaccaacagtgcactttgcccagcgcaagcacgtgatttgctgtcgaaa
atgctggtgatcgatcccgaaaagcgcatatcagtggatgaagctctgaaacatccttat
gtttatgtgtggttcgacgaagctgaagtttatgctccaccaccagaacaatacaatcat
agtattgactcgagagatcatacagttgaacagtggaaagaactaatattcaaagaaatc
atgcactacgagcaaacgcatgacgaatatggaataaagaaatcgttaaattgtacatca
gctgctgcaccatcgtcttcatcatcatcatttcagaacattgagcatggtgattgctca
acaactggaagtactctggttacaaatggcttgtga

DBGET integrated database retrieval system