KEGG   Loa loa (eye worm): LOAG_02973Help
Entry
LOAG_02973        CDS       T02664                                 

Definition
CMGC/MAPK/JNK protein kinase
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:loa04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:loa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:loa04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:loa04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:loa04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 551 aa AA seqDB search
MGDTVIAVYIMLCLQWLGSSNSGGRDDCETEAISLDSCASVLEPSYLEGVYPTPMASTSA
ASEFYNVDINDTRLCVLKRYQNLRIIGSGAQGVVCAAHDTLRDEQVAIKKLSRPFQNVTH
AKRAYREFKLMNLVNHKNIIGLLNAFTPQKTLDEFSDLYIVMELMDANLCQVIQMDLDHE
RMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAGDSFMMTPYV
VTRYYRAPEVILGMGYKDNVDVWSTGCIFGEMIRGSVLFPGSDHIDQWTKIVEQLGTPSP
MFMRRLQSTVRNYVENRPHFLGFPFDKLFPDELFPASSSSDSRLTVDIWSIGCIFGELIR
GRVLFPGTDHIDQWSKIIEQLGTPGRDFMQKLQATVRSYVENRPRHPGLPFEILFSDNIF
PKPATNSALCPAQARDLLSKMLVIDPEKRISVDEALKHPYVYVWFDEAEVYAPPPEQYNH
SIDSRDHTVEQWKELIFKEIMHYEQTHDEYGIKKSLNCTSAAAPSSSSSSFQNIEHGDCS
TTGSTLVTNGL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgggagatactgtaattgctgtgtacattatgctgtgtttgcagtggctgggaagttcg
aattcaggtggtcgtgacgattgcgagacagaagcgatttcgctcgacagttgcgcaagc
gttttggagccgtcctatcttgaaggcgtttatccaactcccatggcttccacttctgct
gcatccgaattttacaacgttgacatcaatgacacacgtttgtgtgttttgaagcgctat
caaaatttaaggataatcgggtctggtgcacagggtgtcgtatgtgctgcacatgatact
cttcgtgatgagcaagtcgctattaagaagctgagtcgtccgttccaaaatgtgacgcat
gctaaacgagcttacagagagttcaaattgatgaatcttgtcaaccataaaaatataatt
ggattgttgaatgcattcacacctcaaaaaacactcgatgaattttccgatttgtacata
gtaatggaacttatggatgctaatttatgccaagtaatccaaatggacttagatcatgaa
aggatgtcctatttgttgtatcaaatgttatgtggtatcagacacttgcatgctgcgggt
atcatacaccgggatctcaaaccgagcaatattgttgttaaaagtgattgtagtttgaaa
atattggattttggtttagcgcgaagtgccggtgattcatttatgatgacgccatatgtt
gtaacacgttactatcgtgcacctgaagttatactagggatgggatacaaagataatgtt
gatgtttggtcaacgggctgtatattcggcgaaatgattcgtggtagtgtattgtttccg
ggcagtgatcatattgaccagtggaccaaaattgttgagcagcttggtactccttcaccg
atgttcatgcgtcgcttgcaatcaactgtccgaaattatgtggaaaatcggccccatttc
cttggttttccattcgataagctcttcccggatgaattatttccagctagcagcagttct
gactcacgacttactgttgatatatggtcgattggctgtatttttggtgaactcattcgt
ggccgagttcttttccctggtacggatcatattgaccagtggtcaaaaatcattgagcag
ctgggaacacccggacgagattttatgcagaagttgcaagcaactgtgaggagctatgtg
gagaatcgtcctaggcatcccggtcttccatttgagattctctttagtgataatatattt
ccaaagccagcaaccaacagtgcactttgcccagcgcaagcacgtgatttgctgtcgaaa
atgctggtgatcgatcccgaaaagcgcatatcagtggatgaagctctgaaacatccttat
gtttatgtgtggttcgacgaagctgaagtttatgctccaccaccagaacaatacaatcat
agtattgactcgagagatcatacagttgaacagtggaaagaactaatattcaaagaaatc
atgcactacgagcaaacgcatgacgaatatggaataaagaaatcgttaaattgtacatca
gctgctgcaccatcgtcttcatcatcatcatttcagaacattgagcatggtgattgctca
acaactggaagtactctggttacaaatggcttgtga

DBGET integrated database retrieval system