KEGG   Loa loa (eye worm): LOAG_02973Help
Entry
LOAG_02973        CDS       T02664                                 

Definition
CMGC/MAPK/JNK protein kinase
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOAG_02973
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    LOAG_02973
   04012 ErbB signaling pathway
    LOAG_02973
   04310 Wnt signaling pathway
    LOAG_02973
   04068 FoxO signaling pathway
    LOAG_02973
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_02973
Protein kinases [BR:loa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LOAG_02973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 551 aa AA seqDB search
MGDTVIAVYIMLCLQWLGSSNSGGRDDCETEAISLDSCASVLEPSYLEGVYPTPMASTSA
ASEFYNVDINDTRLCVLKRYQNLRIIGSGAQGVVCAAHDTLRDEQVAIKKLSRPFQNVTH
AKRAYREFKLMNLVNHKNIIGLLNAFTPQKTLDEFSDLYIVMELMDANLCQVIQMDLDHE
RMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAGDSFMMTPYV
VTRYYRAPEVILGMGYKDNVDVWSTGCIFGEMIRGSVLFPGSDHIDQWTKIVEQLGTPSP
MFMRRLQSTVRNYVENRPHFLGFPFDKLFPDELFPASSSSDSRLTVDIWSIGCIFGELIR
GRVLFPGTDHIDQWSKIIEQLGTPGRDFMQKLQATVRSYVENRPRHPGLPFEILFSDNIF
PKPATNSALCPAQARDLLSKMLVIDPEKRISVDEALKHPYVYVWFDEAEVYAPPPEQYNH
SIDSRDHTVEQWKELIFKEIMHYEQTHDEYGIKKSLNCTSAAAPSSSSSSFQNIEHGDCS
TTGSTLVTNGL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgggagatactgtaattgctgtgtacattatgctgtgtttgcagtggctgggaagttcg
aattcaggtggtcgtgacgattgcgagacagaagcgatttcgctcgacagttgcgcaagc
gttttggagccgtcctatcttgaaggcgtttatccaactcccatggcttccacttctgct
gcatccgaattttacaacgttgacatcaatgacacacgtttgtgtgttttgaagcgctat
caaaatttaaggataatcgggtctggtgcacagggtgtcgtatgtgctgcacatgatact
cttcgtgatgagcaagtcgctattaagaagctgagtcgtccgttccaaaatgtgacgcat
gctaaacgagcttacagagagttcaaattgatgaatcttgtcaaccataaaaatataatt
ggattgttgaatgcattcacacctcaaaaaacactcgatgaattttccgatttgtacata
gtaatggaacttatggatgctaatttatgccaagtaatccaaatggacttagatcatgaa
aggatgtcctatttgttgtatcaaatgttatgtggtatcagacacttgcatgctgcgggt
atcatacaccgggatctcaaaccgagcaatattgttgttaaaagtgattgtagtttgaaa
atattggattttggtttagcgcgaagtgccggtgattcatttatgatgacgccatatgtt
gtaacacgttactatcgtgcacctgaagttatactagggatgggatacaaagataatgtt
gatgtttggtcaacgggctgtatattcggcgaaatgattcgtggtagtgtattgtttccg
ggcagtgatcatattgaccagtggaccaaaattgttgagcagcttggtactccttcaccg
atgttcatgcgtcgcttgcaatcaactgtccgaaattatgtggaaaatcggccccatttc
cttggttttccattcgataagctcttcccggatgaattatttccagctagcagcagttct
gactcacgacttactgttgatatatggtcgattggctgtatttttggtgaactcattcgt
ggccgagttcttttccctggtacggatcatattgaccagtggtcaaaaatcattgagcag
ctgggaacacccggacgagattttatgcagaagttgcaagcaactgtgaggagctatgtg
gagaatcgtcctaggcatcccggtcttccatttgagattctctttagtgataatatattt
ccaaagccagcaaccaacagtgcactttgcccagcgcaagcacgtgatttgctgtcgaaa
atgctggtgatcgatcccgaaaagcgcatatcagtggatgaagctctgaaacatccttat
gtttatgtgtggttcgacgaagctgaagtttatgctccaccaccagaacaatacaatcat
agtattgactcgagagatcatacagttgaacagtggaaagaactaatattcaaagaaatc
atgcactacgagcaaacgcatgacgaatatggaataaagaaatcgttaaattgtacatca
gctgctgcaccatcgtcttcatcatcatcatttcagaacattgagcatggtgattgctca
acaactggaagtactctggttacaaatggcttgtga

DBGET integrated database retrieval system