KEGG   Loa loa (eye worm): LOAG_03313Help
Entry
LOAG_03313        CDS       T02664                                 

Definition
acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    LOAG_03313
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_03313
Transcription machinery [BR:loa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     LOAG_03313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 714 aa AA seqDB search
MKLLSEDELLDEKSWKKLAMHTRCSLCHCRGWKLMCDSENPYVITSAFLDDVLFSTPCET
CKHSLGRHLDRLQEKKKNDVKKLLLMMSDAEKMQERLIGDESSEILQVVQQTQRALTKEI
SSGSCEGSITCSFGFPPFEPVSIEDIVSNFVVNKSGGKQNLFRYRINENLEDLTAEETVS
CPNLLSYRIIYARWLRFCSLPKKHGSLRLYCVIKIFGRKFLITLLPFFISDVKERANFFK
DQVIGKLIDFASDLRKNLSCNDSLTDSSILLTFPEGVSRPTLKRGCSVWVVEPHLDITAN
FFGTESEQSNSSMQLEIGREVDESLMVRLIARMELTYRTSKPLVHRMDAFEVDVARSEVS
RLEECNGIISFHVISNNFDTDQSRQKLAWLLQLQCLFSTQLPRMPKEYITRLVFDNRHKN
LVIVKKGRGVIGGICFRQFPAQGFIEIVFCAVTANEQVKGYGTRLMNHLKDYHVEACHIY
HFLTYADEFAVGYFKKQGFSEKIAMDKKQYHGYIKDYEGATLMGCQLHPWIVYTNFAVCL
KRLHDVYRNAVKESFFEEEKKCPGVENVFQWHEGSLVPYAELPGLEQCKDESVPHEELQH
KIRSILHKLRADKSSWPFLKPVNAEEVPEYYGYIKFPTDLKTINERCRAKYYVHERLFVA
DLRRLFNNCFKFNAPKTLYYKAGYDLAETARKLCQKAFPYLDIYPELPDAKPEL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgttgtccgaagacgagttgttagatgagaaaagctggaaaaaactagcgatg
cacacgagatgctctctgtgtcattgtcgcggttggaaattaatgtgtgatagcgagaat
ccctatgtgataaccagtgcttttcttgatgacgttcttttctcaacaccttgcgaaaca
tgcaagcactctcttggaagacatttagacaggttacaagagaagaaaaaaaatgatgtt
aaaaagttattgttgatgatgtcagatgcagagaaaatgcaggaaaggcttatcggagac
gagtcttctgaaattctgcaggtcgttcagcaaactcagagagctttaacgaaagaaatc
agcagcggtagttgtgaaggatcaattacatgttcgtttgggtttccaccatttgagcct
gtatcaattgaagacattgtttcgaatttcgttgtcaacaaaagcggtgggaaacaaaat
ttatttcgatatcgtattaatgagaatctggaagatttgacagcagaagaaacagtgtcc
tgtccaaatctgttatcttatcgtatcatctatgcaaggtggttgcggttctgttccttg
cccaagaagcacggatctcttcgactatattgtgttattaagatctttggtcgcaaattt
ctaatcactttgcttccattttttataagtgacgtgaaagagcgtgctaattttttcaaa
gatcaggtcatcggaaaactaattgattttgcatctgacttaagaaaaaatttgagttgc
aatgactcgctgacggattcatctatattacttacttttcctgagggagtttctcgcccc
actctcaaacgaggatgttccgtttgggttgtcgagcctcatctagacataactgcaaat
ttttttggaacagaatctgaacaatcaaattcaagtatgcaacttgaaataggacgtgag
gttgatgagtctttgatggtacgattaattgctcgtatggaattgacatataggacatcg
aaacctctggtgcatagaatggatgcttttgaagtagacgttgctaggagtgaagtatcg
cgattggaggaatgtaatggtatcatttcttttcatgtaatttcaaataatttcgacacg
gatcagagccgtcaaaagctggcatggttattgcagctgcaatgtttgtttagtacacaa
ctgcctcgcatgcctaaagagtatatcacgaggcttgttttcgataatcgtcacaaaaat
ttggtcatcgtcaaaaaagggcgaggtgtaattggaggtatttgctttaggcaatttcca
gcacaagggtttatcgaaatcgtattttgcgctgtaactgcaaatgaacaggtaaaaggt
tatggtactcgtttgatgaatcatttgaaagattatcatgtggaagcttgtcatatatat
cacttcttgacatatgcagatgaatttgctgttggttacttcaaaaaacaaggcttttcc
gaaaaaatagcaatggacaaaaagcagtatcatggttacatcaaagactatgaaggggca
acgttaatgggctgccaattacatccatggatagtttatacaaactttgcggtatgtttg
aaacgccttcacgatgtttatcgaaatgccgtgaaagaaagttttttcgaggaagagaaa
aaatgtccaggagttgaaaacgtcttccagtggcatgaaggatcgttagttccatatgcc
gagttgcctgggttagaacaatgtaaagatgagtcagtgccacatgaagaacttcagcac
aaaattcgaagcatacttcataaattgcgggctgataaatcgtcatggccatttctaaaa
ccagtaaatgcggaggaagttccggaatactatggttacattaaatttcctactgatttg
aaaacaataaatgagcgctgtagagcgaagtattatgtgcatgaaagactgtttgttgcc
gatcttcgacggttatttaacaactgtttcaaattcaatgcacctaaaactttgtattat
aaagcaggatatgatttggcagagactgcccgaaagctatgtcaaaaagcattcccatat
ttggacatatatccagaacttcctgatgcaaaacccgaactgtag

DBGET integrated database retrieval system