KEGG   Loa loa (eye worm): LOAG_03428Help
Entry
LOAG_03428        CDS       T02664                                 

Definition
(RefSeq) UDP-glucoronosyl and UDP-glucosyl transferase
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
loa  Loa loa (eye worm)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LOAG_03428
   00053 Ascorbate and aldarate metabolism
    LOAG_03428
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    LOAG_03428
   00860 Porphyrin and chlorophyll metabolism
    LOAG_03428
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    LOAG_03428
   00982 Drug metabolism - cytochrome P450
    LOAG_03428
   00983 Drug metabolism - other enzymes
    LOAG_03428
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     LOAG_03428
Glycosyltransferases [BR:loa01003]
 Others
  Hydrophobic molecule
   LOAG_03428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
AA seq 431 aa AA seqDB search
MHRLQWYLASLIVVFCVSANDAYKILIYNPRFGKSHVEFLGSIADTLTEFAPVLFKSFDS
TGSKLAKTIRIDADPEISKMMNIEIFAQNAWLENQQSIFSLIPTIKQLSDALVKNCEFQL
KHEKIMEELKAEKFDLAIFEFNQCFAGMIELFHIPAHIIVSPTALFEYATKCFGVPNIPS
YIPNLLTQYTDHMTYLQRVKNLIVTILTNKLLDNLTAKCQTLFRRLYGDQFIDLKEKLAQ
VTYVLTNTDPLFHISRPTIHKMLELGGLALPKSKPLNKDWLTIMNQRKAVVLVSFGTITL
SCWMPNKTKQALLEVFDNFPNVTFIWKYEKDEHQITDRHPNVITSKWLPQSDLLAHTNLI
AFLTHGGMNSITETLNYGKPVVVVPLFGDQMQNAVLVERSGFGIKLSLSELAIKKKHGMQ
SITSFMIKGKL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtcttcagtggtatttggcttctcttattgtcgtattctgtgtatctgcaaat
gatgcatataaaatattgatatacaatccacgtttcggtaaaagtcacgtcgaatttttg
ggttctatcgctgatacattgaccgaatttgcccctgtacttttcaaatcttttgattcg
accggttctaaacttgccaaaacaatacggatagatgctgatccggaaatatcaaaaatg
atgaacatagaaatttttgctcaaaatgcttggttggagaatcagcaatctattttctct
cttattccgaccattaaacaactgtcggatgctcttgtaaagaactgtgagtttcaattg
aaacacgaaaagataatggaggaattgaaggctgaaaagtttgacttggccattttcgaa
tttaatcagtgctttgctggaatgattgaactgtttcatataccagctcacattatcgtt
agtcctactgctttatttgaatatgccacaaaatgttttggtgtaccaaacatcccgagt
tatattccaaatttgcttacacaatataccgatcatatgacatatttacaacgggtgaaa
aatctcatcgtgacaattttaacgaataaattgttggataatcttacggcaaaatgtcaa
acattattccgacgactttacggcgatcagttcatcgatttaaaggaaaagttagctcaa
gtgacatatgtgctcacaaatactgatccacttttccatatctcaagaccaactattcat
aaaatgttagaacttggtggtcttgctttgccaaaatcaaaaccattaaataaagattgg
cttacaataatgaatcaacggaaagcagtagtgctcgtatcattcggtaccattacatta
agctgttggatgcccaataaaactaagcaagctctcctggaagtattcgataactttcca
aatgtgacatttatctggaaatatgaaaaagatgagcatcaaattactgacagacatcca
aatgtgattacgtcaaaatggcttccgcaatctgatttattagcacatacaaatttaata
gcatttttgacgcatggtggtatgaatagcataacggaaactttgaattatggaaaacct
gttgttgtggtaccgttatttggtgatcagatgcaaaatgctgtactggttgaacgatca
ggctttggtatcaaattatcactttcggaactagcaataaaaaaaaaacacgggatgcaa
tcaataacatcatttatgataaaaggtaaactttga

DBGET integrated database retrieval system