KEGG   Loa loa (eye worm): LOAG_03494Help
Entry
LOAG_03494        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LOAG_03494
Peptidases [BR:loa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LOAG_03494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MPSPAQWLPLESNPEVITNFMHKIGVEKGVECVDIYSFEDDILAFIPRPCYAVMLCFPMV
DKVDEIMQPIYEKMKEEGSVVPDGIFFMKQKISNACGTFALIHSLANNQNKINLGDGSLK
QWLDKAVSLGVEERSDSLAENSTLAEAHYDCARGGETDSSAPIDHHFICYLNYGDKLLEL
DSRAPSPRICGLTSDATFLKDVGNSCKTLMNKLDNISFSALAIVRASH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtcctgctcaatggcttccactagaatcaaatccggaagtgattacaaatttt
atgcacaaaattggtgtggagaaaggagtagaatgtgtggatatatacagttttgaggat
gatatattggctttcataccacgaccgtgttatgcggttatgttgtgcttcccgatggtt
gacaaggttgatgaaatcatgcaacctatctatgaaaaaatgaaagaggaagggagcgta
gtaccagacggtatcttttttatgaaacaaaaaatatcaaatgcttgtggaacttttgcg
ctgattcattcgcttgccaataatcaaaacaaaattaatcttggtgatggatcactgaaa
caatggttagataaagcagtatcattgggtgttgaagaaagatctgattcgttggccgaa
aactcaacacttgcggaagctcattatgactgcgctcgaggtggtgagaccgattcgagc
gcgcctattgaccatcatttcatctgttaccttaactatggggataaactgctcgaactt
gattctcgtgctccatctcctcgtatttgtggtttgaccagcgatgcaacgttcctgaaa
gatgttggaaattcctgcaagacattgatgaacaaattggacaacatatcatttagtgcg
cttgctatcgttcgtgcgtcccattaa

DBGET integrated database retrieval system