KEGG   Loa loa (eye worm): LOAG_03918Help
Entry
LOAG_03918        CDS       T02664                                 

Definition
(RefSeq) acetylcholinesterase 1
  KO
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
loa  Loa loa (eye worm)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LOAG_03918
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     LOAG_03918
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:loa00537]
 Enzymes
  LOAG_03918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 626 aa AA seqDB search
MMNIALHFLTFLTLLLKPVVNQLVTLHDGSPLFGREVHAENGKLVTEFLGIPFAEPPVGQ
LRFRKPKPKQPWRTPFNATTMPNACMQSLDTYFGDFEGATMWNSNVPVSEDCLYLNLIIP
GQINRNARLPVMVWIYGGGFWSGCISLDVYDPKIITSEENVIFVAMNYRVSVFGFLYMGR
EEAPGNMGLWDQLLALKWVRKNIDLFGGDPNQVTLFGESAGAAAVSMHLLSPRSSPYFQR
AIIQSGSATAPWATESREIAITRSIVLYDNMQCGNMSKDPQNWDLEKVLRCLIDAPAEAI
RDSEWAPVMEFADFPWVPVIDGDFLIEQPTTSLKRGNFKVAELLIGSNMEEAIYFIVYQL
GDIFPPKDFFIKNDFVTSREEWLHSISNLLPRKMLQSPLALASIIHEYEPADLPIKPSDW
INSLDKMLGDLQFTCNSNEIALANSMHGGDTYYYYFTHRSSQQSWPKWMGVVHGYEINFV
FGEPLNTKKFSYTKEEQELSMRFMRYWANFARTGNPNKNPDGTYTSDVWPQYTQTTMEYM
NLTVESNYYAGASRIGTGPRRKQCSFWKKILPNLMAAVADTGDQVMRWKQEMNRWENEYI
IDWKLYFEQYKKYQAYRYADSTSGQC
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattgccttgcatttcttgacgtttcttactttacttctcaagccagttgta
aatcagcttgtaacattacatgatgggtcaccactgtttggtcgtgaagtgcatgctgaa
aatgggaaattggttacggaatttctcgggataccatttgcagaaccaccagttggacaa
ttgaggtttcgaaaaccaaaaccaaagcaaccatggcgaacaccatttaatgctacaact
atgccaaatgcctgcatgcagagtttggatacatattttggtgatttcgaaggagcaaca
atgtggaatagtaatgtgcccgtatccgaagattgtctttacctcaatttaattataccg
ggacagatcaatcgaaatgctcgattaccggttatggtatggatatatggtggaggattt
tggtctggatgcatatcattggatgtttatgatccaaaaattattactagcgaagagaat
gtgatatttgtggccatgaattaccgcgttagtgtgtttggctttttatatatgggccga
gaagaagcacctggtaatatgggcctatgggatcaacttctagcattgaaatgggttcga
aaaaatatcgatttatttggaggagatcctaatcaagtgacattatttggtgaaagtgct
ggtgcagcagcagtttcaatgcatttattaagtccaagaagttcaccgtattttcaacga
gcaattatccaaagtggaagtgctacagctccttgggctacagaatccagagagatagca
attacacgatccattgttttatatgataatatgcaatgtggaaatatgtcaaaagatcct
cagaattgggatcttgaaaaggtgttacgatgtctaatagatgcaccagcagaagcgatc
cgtgattcagaatgggcacctgtaatggaatttgccgatttcccgtgggttccggtaatt
gacggtgatttcttgattgagcaaccgacaacatcactcaaacgaggcaattttaaagtt
gctgaattgctcattggctcgaatatggaggaagctatttatttcattgtttatcagttg
ggtgatatttttccaccaaaagatttcttcataaagaatgattttgtgacaagtcgcgaa
gaatggttacatagtatatcaaatttattaccccgaaaaatgctgcaatctccgttagca
ttagcatcgattatccatgaatatgaaccagctgatctaccaattaagccatctgattgg
attaattcattggataaaatgcttggtgatttacaattcacatgtaatagcaatgaaatt
gcattggctaatagcatgcatggaggtgatacttactattattacttcacgcatcggtca
agtcaacaaagttggcccaaatggatgggtgttgtacacggatatgagataaatttcgta
tttggtgaaccattgaatacgaagaaattttcgtatactaaagaagagcaggaattaagt
atgagattcatgcgatattgggctaattttgcccgtaccggaaatccgaacaagaatccg
gatggaacgtatacatcagatgtttggccacaatatacacagacaacaatggaatatatg
aatttaacagtcgaatccaattattacgctggagcatcacgtattggtactgggccaaga
aggaaacaatgttcattctggaagaaaattctaccaaatttgatggctgccgtagccgat
actggcgatcaagtaatgcgttggaaacaagaaatgaaccgttgggagaatgagtatatt
attgattggaagctttactttgaacaatacaaaaaatatcaagcatatcgatatgccgat
tcaacaagtggtcaatgttaa

DBGET integrated database retrieval system