KEGG   Loa loa (eye worm): LOAG_04612Help
Entry
LOAG_04612        CDS       T02664                                 

Definition
phosphatidylinositol 3
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
loa  Loa loa (eye worm)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LOAG_04612
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    LOAG_04612
   04630 Jak-STAT signaling pathway
    LOAG_04612
   04068 FoxO signaling pathway
    LOAG_04612
   04070 Phosphatidylinositol signaling system
    LOAG_04612
   04150 mTOR signaling pathway
    LOAG_04612
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     LOAG_04612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 948 aa AA seqDB search
MQGVICPQDSPDVWSVIECGQLEVEGSTDLDLLLPNGFLVTVRCSMDFTLAMLKQELFIQ
AKKLPLFNLLLTPSDYIFFTIRTDGEREELYDESRSIFSLRLFVPLLCLIEPEGNREEKE
LTHDIGLAIGRPLAEIEAKLSSEEMSYRMDLYRVSEQAVSNRGVVGYSHYAFPEEVSSEL
DADIPLQVKSKIQMADLYIELWYRSREDELANIDTNCVCVKIRKVIGVHASDAVANAIKE
LMQQHKLFIKEAASDFLLQIAGRRCFLTKDIKLTSFEYVRSSFENYRIPKFILRRKDIVM
KDFTEPPSITKPSWVRAYESRLDRADEIAMKECSLWKVDDNLKLRIHSASHLSILDFDKI
YVKASLYHGIDLIANKESTCVSPSNPRWSDEYSGIGWVNIRLFDCNGKLVQGKFMLYLWP
FPKYCTELLYPSGQVGSNDNRDTVRIEVEFEDYGCIEFPGVDSVCEYVEKLDVRSTRLPL
SSLSSPANSVKEFLESLRFVDVEDLTDKQMEQLWEARELVAQYKPDLLPLIARCPLIWTR
RSEFSRLYELLNRWGKIQPETALVLLDFKYPDRRIREFAVDSLDNVLDNDRLHLYILPLI
QVLKFEPYGSCALSRMLLKRALCNNRIGHILFWLLRAELGQLSEVGQNLTKIYKRFALMI
EAYCRANYIHLNSMLRQVDMVVRLTNLSKIIKTMKDNECATKHLQKELASYVEIMQNMIS
PLDISDSLGELNIELCKVIGSAKQPLRLAWTNPEPLARLHSETHQIIFKNGDDLRQDMLT
LQVMRIMDALWKSKDYDLCLSIYEVLPMGRNVGMIYVVQNCSTLFEIQCAAKQLGSTFSM
ESGLINKYIRNCSENSKVYLEGVDRFTASCAGYCVATYVLGIKDRHQDNIMLAKDGRMFH
IDFGHFLGHYKKKLGINRDRVPFVLTDHFLCVIAKGKSNFRDSHEYKK
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggagtgatttgtccgcaggactcacccgatgtgtggtcagtcatagaatgtgga
caactggaggtggagggtagcacggatctcgatttacttttaccaaatggtttcttggtc
actgtacgatgttctatggatttcacccttgctatgcttaaacaagaattattcatacaa
gcgaaaaaattaccgctgttcaatcttttgttgacaccgtcggattatatattttttacg
attagaacagatggtgaacgtgaagaactatacgatgaatcgcgttccatattttcatta
cggcttttcgtgccactactttgcttgattgagcctgagggcaatcgtgaggaaaaagaa
ctcacacatgatatcggtctagctattggacgtccgttggcagaaattgaagcgaaatta
tcctccgaagaaatgtcatatcgtatggatttgtacagagtgtcagaacaagcagtttct
aatcgcggagttgtcggctattctcattatgcattccctgaagaggtttcaagtgagtta
gatgctgatatcccactacaagtcaagtcaaaaatccaaatggcagatttatacattgag
ttatggtatcgcagtagagaggatgagctggcaaatatcgatacgaattgtgtttgtgtt
aaaattcgtaaagttattggtgttcatgcttcagatgcagtagcaaatgcaataaaggag
cttatgcaacaacataaattatttatcaaggaagctgcttctgatttcttgttgcaaata
gcaggacggcgctgttttttaaccaaggatatcaagttaaccagcttcgagtatgtcaga
tcatccttcgagaactatcgcataccgaaattcatattgcggagaaaagacattgtgatg
aaagattttacggaacctccatccataaccaaaccaagttgggtacgagcgtatgagagt
cgactcgatcgagctgatgaaattgccatgaaagaatgttctctatggaaagtggatgat
aatctaaaattgcgaatacacagcgcatctcatttaagtatattagattttgataagata
tatgtgaaagcatccctatatcatgggatagatcttattgcgaataaagaatcaacttgt
gtttctccttcaaatccgcgttggagtgatgaatatagtggaattggttgggtgaatata
cgtcttttcgattgcaatgggaaactcgttcagggcaaattcatgctttatttgtggcct
tttccgaaatactgcaccgaattactttatccatccggacaagtagggtcaaatgacaat
cgcgatacagttcgtattgaagtggagtttgaagattatggatgcatcgaatttccaggt
gtagattcagtgtgcgaatatgtcgaaaagctggatgttcgcagtacaagattgccttta
tcatctttatcttcaccagctaattcagtgaaggaatttcttgaatctttacgatttgtg
gacgttgaagatttaaccgacaagcaaatggaacagttatgggaagcaagagagttagtt
gcacaatataagcctgatttattaccattaattgcacgctgtcccttgatttggacgaga
agaagcgaattttcacgattatacgaattattaaatcgatggggtaaaattcaaccagag
acagctttggtacttctggatttcaaatatcctgatagaagaatccgagaatttgcagta
gattcacttgataatgttttggacaatgacagattgcatctttatattttgcctctcatt
caggtattgaaatttgagccttatgggtcgtgtgctttgagcagaatgcttctgaaaaga
gcgctgtgtaataatcgtattggtcatatattgttttggttactgcgagctgaacttgga
caactaagtgaagtaggtcagaatttaacaaagatttacaaacgttttgcattaatgatt
gaggcctattgtcgagctaactatattcatcttaattctatgttacgacaagtcgatatg
gtagtcagattgacaaatcttagtaaaattatcaaaaccatgaaggataatgaatgcgcc
accaagcatttgcaaaaagaattggcgtcatatgtggaaataatgcagaatatgatctca
cctctagatatttccgatagtttaggcgaattaaacattgaactttgcaaggtgatagga
agtgcgaaacaaccacttcggttagcttggactaatccagaacctcttgctcgattgcat
agtgagacgcatcaaattatcttcaagaatggtgacgatctgcggcaggatatgctaact
ttacaagttatgcgtattatggatgcactgtggaaaagcaaagattatgatctctgctta
agcatttatgaagtattgccaatgggaagaaatgttggaatgatttatgttgttcagaac
tgcagtacacttttcgaaattcagtgtgctgcaaaacaactcggctcaacgttcagtatg
gaaagcggtcttattaataaatatatacgaaattgttcggagaattcaaaagtatatttg
gaaggagttgatcgttttactgcttcatgtgccggatattgtgttgcaacatatgtgttg
ggaatcaaggatagacaccaggataatatcatgctagccaaagatggaaggatgttccat
atcgattttggacattttttggggcattataaaaagaaattaggtattaatcgtgaccga
gtaccgtttgttctgaccgatcactttctgtgtgttatagccaaaggcaaaagcaatttc
cgtgacagccatgaatataaaaagtaa

DBGET integrated database retrieval system