KEGG   Loa loa (eye worm): LOAG_04612Help
Entry
LOAG_04612        CDS       T02664                                 

Definition
phosphatidylinositol 3
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
loa  Loa loa (eye worm)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:loa00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:loa04012]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:loa04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:loa04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:loa04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:loa04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 948 aa AA seqDB search
MQGVICPQDSPDVWSVIECGQLEVEGSTDLDLLLPNGFLVTVRCSMDFTLAMLKQELFIQ
AKKLPLFNLLLTPSDYIFFTIRTDGEREELYDESRSIFSLRLFVPLLCLIEPEGNREEKE
LTHDIGLAIGRPLAEIEAKLSSEEMSYRMDLYRVSEQAVSNRGVVGYSHYAFPEEVSSEL
DADIPLQVKSKIQMADLYIELWYRSREDELANIDTNCVCVKIRKVIGVHASDAVANAIKE
LMQQHKLFIKEAASDFLLQIAGRRCFLTKDIKLTSFEYVRSSFENYRIPKFILRRKDIVM
KDFTEPPSITKPSWVRAYESRLDRADEIAMKECSLWKVDDNLKLRIHSASHLSILDFDKI
YVKASLYHGIDLIANKESTCVSPSNPRWSDEYSGIGWVNIRLFDCNGKLVQGKFMLYLWP
FPKYCTELLYPSGQVGSNDNRDTVRIEVEFEDYGCIEFPGVDSVCEYVEKLDVRSTRLPL
SSLSSPANSVKEFLESLRFVDVEDLTDKQMEQLWEARELVAQYKPDLLPLIARCPLIWTR
RSEFSRLYELLNRWGKIQPETALVLLDFKYPDRRIREFAVDSLDNVLDNDRLHLYILPLI
QVLKFEPYGSCALSRMLLKRALCNNRIGHILFWLLRAELGQLSEVGQNLTKIYKRFALMI
EAYCRANYIHLNSMLRQVDMVVRLTNLSKIIKTMKDNECATKHLQKELASYVEIMQNMIS
PLDISDSLGELNIELCKVIGSAKQPLRLAWTNPEPLARLHSETHQIIFKNGDDLRQDMLT
LQVMRIMDALWKSKDYDLCLSIYEVLPMGRNVGMIYVVQNCSTLFEIQCAAKQLGSTFSM
ESGLINKYIRNCSENSKVYLEGVDRFTASCAGYCVATYVLGIKDRHQDNIMLAKDGRMFH
IDFGHFLGHYKKKLGINRDRVPFVLTDHFLCVIAKGKSNFRDSHEYKK
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggagtgatttgtccgcaggactcacccgatgtgtggtcagtcatagaatgtgga
caactggaggtggagggtagcacggatctcgatttacttttaccaaatggtttcttggtc
actgtacgatgttctatggatttcacccttgctatgcttaaacaagaattattcatacaa
gcgaaaaaattaccgctgttcaatcttttgttgacaccgtcggattatatattttttacg
attagaacagatggtgaacgtgaagaactatacgatgaatcgcgttccatattttcatta
cggcttttcgtgccactactttgcttgattgagcctgagggcaatcgtgaggaaaaagaa
ctcacacatgatatcggtctagctattggacgtccgttggcagaaattgaagcgaaatta
tcctccgaagaaatgtcatatcgtatggatttgtacagagtgtcagaacaagcagtttct
aatcgcggagttgtcggctattctcattatgcattccctgaagaggtttcaagtgagtta
gatgctgatatcccactacaagtcaagtcaaaaatccaaatggcagatttatacattgag
ttatggtatcgcagtagagaggatgagctggcaaatatcgatacgaattgtgtttgtgtt
aaaattcgtaaagttattggtgttcatgcttcagatgcagtagcaaatgcaataaaggag
cttatgcaacaacataaattatttatcaaggaagctgcttctgatttcttgttgcaaata
gcaggacggcgctgttttttaaccaaggatatcaagttaaccagcttcgagtatgtcaga
tcatccttcgagaactatcgcataccgaaattcatattgcggagaaaagacattgtgatg
aaagattttacggaacctccatccataaccaaaccaagttgggtacgagcgtatgagagt
cgactcgatcgagctgatgaaattgccatgaaagaatgttctctatggaaagtggatgat
aatctaaaattgcgaatacacagcgcatctcatttaagtatattagattttgataagata
tatgtgaaagcatccctatatcatgggatagatcttattgcgaataaagaatcaacttgt
gtttctccttcaaatccgcgttggagtgatgaatatagtggaattggttgggtgaatata
cgtcttttcgattgcaatgggaaactcgttcagggcaaattcatgctttatttgtggcct
tttccgaaatactgcaccgaattactttatccatccggacaagtagggtcaaatgacaat
cgcgatacagttcgtattgaagtggagtttgaagattatggatgcatcgaatttccaggt
gtagattcagtgtgcgaatatgtcgaaaagctggatgttcgcagtacaagattgccttta
tcatctttatcttcaccagctaattcagtgaaggaatttcttgaatctttacgatttgtg
gacgttgaagatttaaccgacaagcaaatggaacagttatgggaagcaagagagttagtt
gcacaatataagcctgatttattaccattaattgcacgctgtcccttgatttggacgaga
agaagcgaattttcacgattatacgaattattaaatcgatggggtaaaattcaaccagag
acagctttggtacttctggatttcaaatatcctgatagaagaatccgagaatttgcagta
gattcacttgataatgttttggacaatgacagattgcatctttatattttgcctctcatt
caggtattgaaatttgagccttatgggtcgtgtgctttgagcagaatgcttctgaaaaga
gcgctgtgtaataatcgtattggtcatatattgttttggttactgcgagctgaacttgga
caactaagtgaagtaggtcagaatttaacaaagatttacaaacgttttgcattaatgatt
gaggcctattgtcgagctaactatattcatcttaattctatgttacgacaagtcgatatg
gtagtcagattgacaaatcttagtaaaattatcaaaaccatgaaggataatgaatgcgcc
accaagcatttgcaaaaagaattggcgtcatatgtggaaataatgcagaatatgatctca
cctctagatatttccgatagtttaggcgaattaaacattgaactttgcaaggtgatagga
agtgcgaaacaaccacttcggttagcttggactaatccagaacctcttgctcgattgcat
agtgagacgcatcaaattatcttcaagaatggtgacgatctgcggcaggatatgctaact
ttacaagttatgcgtattatggatgcactgtggaaaagcaaagattatgatctctgctta
agcatttatgaagtattgccaatgggaagaaatgttggaatgatttatgttgttcagaac
tgcagtacacttttcgaaattcagtgtgctgcaaaacaactcggctcaacgttcagtatg
gaaagcggtcttattaataaatatatacgaaattgttcggagaattcaaaagtatatttg
gaaggagttgatcgttttactgcttcatgtgccggatattgtgttgcaacatatgtgttg
ggaatcaaggatagacaccaggataatatcatgctagccaaagatggaaggatgttccat
atcgattttggacattttttggggcattataaaaagaaattaggtattaatcgtgaccga
gtaccgtttgttctgaccgatcactttctgtgtgttatagccaaaggcaaaagcaatttc
cgtgacagccatgaatataaaaagtaa

DBGET integrated database retrieval system