KEGG   Loa loa (eye worm): LOAG_04651Help
Entry
LOAG_04651        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
loa  Loa loa (eye worm)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LOAG_04651
   00053 Ascorbate and aldarate metabolism
    LOAG_04651
   00500 Starch and sucrose metabolism
    LOAG_04651
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    LOAG_04651
   00860 Porphyrin and chlorophyll metabolism
    LOAG_04651
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    LOAG_04651
   00982 Drug metabolism - cytochrome P450
    LOAG_04651
   00983 Drug metabolism - other enzymes
    LOAG_04651
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     LOAG_04651
Glycosyltransferases [BR:loa01003]
 Others
  Hydrophobic molecule
   LOAG_04651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 442 aa AA seqDB search
MIAFIGLLLVLLPLPNMNEAANVLIMPSSLFPVHRFTMRTLAKELIKRKHNVTWVEYGFS
RKSKISLPKEIDEIFWRVKSSNQEINDLYLHRNHSVHSRIWDADFNDDTEQTTAWLASIK
MCEQILLTRKQEFDALVTKNFTTVIVDDLYNPCGLLLVGLQKSVFIYWSMTVLRTESAWS
SQSPNSPSYLPVFGTRFTDDLTFLQRLYNFASYFRSLYIHQHLILRRIDNLYKKYYADTL
ANAYYIERNVSINFVNTPQIFDFARPYMPRVAFIGAIECRKANLLRREWLTFIDKADAKN
GFILFTTGFTAQWNLAPKQVIESFVQTFAKMREIHFIWQYNGPNILNLSANVYIAEWLPQ
QDLLGHPKARAHITHGGLNSVIESVWHGIPVIGYPLTTSGYDNLLRLTARNVGIMLEKRD
LSEGNIAKAIKEIYNSKKVLIF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatagctttcattggcttgcttttggttctgctcccacttccaaacatgaatgaagca
gcgaacgtattgatcatgccaagctcactatttccggttcatcggttcacgatgcgtact
ctcgccaaagagttgataaaacggaaacacaatgttacgtgggttgaatatggtttctcc
aggaagagtaaaatcagtctcccaaaagaaatagacgaaatcttctggagggtgaagtcg
tcaaatcaggaaataaatgatttatacttgcatcggaatcactcagtacattctcgtata
tgggatgccgatttcaatgatgacacggagcaaacaacagcttggttggcgagtatcaaa
atgtgtgagcagattttgcttacccgtaaacaagaattcgatgctttggtgaccaaaaat
tttacaacggtgattgtggatgatctgtataatccatgtggtttactactggttggtttg
caaaaaagtgtttttatctactggtctatgactgttttacgtactgaatcagcttggagc
agtcagagtcctaattctccgagttatttgcctgtttttggcactagattcaccgatgat
ctaactttcctgcagcgactatacaactttgcttcatattttcgatcgctctacattcat
cagcatttgattttgagaagaatcgacaacctgtataagaagtattatgcagacacgctg
gcgaatgcatattacatcgagcgaaatgtttcaattaactttgttaatacacctcaaatt
ttcgattttgcgcggccgtatatgccacgagttgctttcattggagctattgaatgccgg
aaggcaaatttgctcaggagagagtggcttacttttattgataaagcagatgcgaaaaat
gggttcatattgtttaccacaggttttacagcacaatggaatcttgcaccaaagcaagta
attgagagctttgtacagacatttgcgaaaatgcgtgaaatacactttatttggcaatac
aatggtccaaatattttaaacttatctgctaatgtatacattgcagaatggcttccacaa
caggatttactaggacatccgaaagcgcgagctcatataacgcatggtggtctaaatagc
gttattgaaagtgtttggcatggtatacctgtgataggctacccgttgactacttccggt
tacgataatttactgcgtttgacagcacgaaatgttggcataatgcttgaaaaacgggat
ttaagcgagggaaatatcgcaaaagctatcaaggagatttataattcgaagaaagttttg
attttctaa

DBGET integrated database retrieval system