KEGG   Loa loa (eye worm): LOAG_04812Help
Entry
LOAG_04812        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
loa  Loa loa (eye worm)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LOAG_04812
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LOAG_04812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 286 aa AA seqDB search
MIDIVVCGSIVQDLVSYTDQFPRPGEAVKGTFATSPGGKGANQAAQAAMLGATVYMIGRV
GKDVFGVCNVESLKIFGVNTKYIDVSESEKTGCSTVIVTKDGQNAIVVAPGANLEYSSSR
IDELEEVIASTKLVLLKTFLNYAPVEETFAKSILKLADILCANEIEAEYLADQCIKSIED
AQKAARKLLDVGPLIVILTLGAKGVVYDSKQGDSGHISVPAVKVVETTGAGDSFCGAFAY
FLVKRSELVLKEQIRRAAHISTLSVQRKGTRDSYLWPKDLPSNLIM
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgattgacattgttgtttgcggaagtattgttcaagatttagtaagttacacggatcaa
tttccacgaccaggtgaagcagtaaaaggtacatttgcaacatcaccaggtggaaaaggt
gctaatcaagctgctcaagctgctatgttaggtgcgacagtatacatgatcggaagggtt
ggtaaagatgtatttggagtatgtaatgtggagagtttgaaaatttttggcgtaaatact
aaatatattgatgttagtgagagtgaaaaaactggctgctctacagtaattgttacaaaa
gatggtcaaaatgcgatagtagttgcaccaggtgcaaatctagaatattcatcatcccgg
attgatgaactggaggaagttatcgcttccacaaaattggtacttttaaaaacatttctg
aattatgctccagttgaagagactttcgctaaaagtattttaaaattggcagacatatta
tgcgcaaatgaaattgaggcagaatatctcgcagatcaatgtattaaatctattgaagat
gcgcaaaaagctgccaggaagttactggatgttggtccattaattgtgattttaactctc
ggagcgaaaggtgttgtatatgatagcaaacagggtgattcaggtcacataagcgtacca
gcagtcaaagttgttgaaactacgggtgctggagatagtttttgtggtgcatttgcatat
ttcctcgtgaagcgatctgaattggtgctaaaagaacagatccgacgtgctgcacacatt
tctaccctttcagtacaacgaaaaggtacccgtgattcgtatctatggccaaaagatcta
ccttcgaacttaataatgtga

DBGET integrated database retrieval system