KEGG   Loa loa (eye worm): LOAG_04841Help
Entry
LOAG_04841        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     LOAG_04841
Protein kinases [BR:loa01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   LOAG_04841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 722 aa AA seqDB search
DDGVENEHLDDSAEWQFLEPLCDISVSESVKQLGHLNSLDNRNYGQFEHDQHSSHLSEGN
RELIHRWQQLAKWCAKHPDDPWIKFRFDKLPVRKCKRHRYSSIQQCWTVDNVQVKLHPEP
FARGAMRECYRLKKLVSRGKNDDWDHAQNYVAKKYIRSVDKEVLFEDVKLQMDSKLWAEE
FNRHHPPKKIDIFQVCILEFLDEDEHTFYHLERFIEGEYIKYNSNSGFVSDVCRQTPQAF
SHFTFERSGHQLIVVDIQGVGDLYTDPQIHTATGEGYGSGNLGTKGMALFFHSHFCNDIC
RSMCLTEFDLAESERNALKGGGNVERNWNSVTRSSSNRPASICSSLVEERGNAMDELRRR
TVSVNSSGRRSSVSSFCDEQSSDTQCSDVRLSNDCFEQVIRDSDKPMAKAQITSSSSSNL
CDSTDSEMKERIYHDPQFGSLSSCSSKMTGHITQEAEREAYWLEKRKFSRPAGLLSESQI
KELSEFSQKIHGINCILGQIHLDLARYHELGQFVEKSAFVCSEKENVYSTKDYGYKKRNC
IGYDKDAAFYHLDIARRCGVLEAIITMAKMAFGQSHELLKEIVCGEVWENEDLEGTGFEL
MECAADMGDQSAVIFVAQAYETGRFLGPMKKPSWPKAVAWYEKALNFLQSSETNENETPH
EGVRPRYELLERMAVMYREGGYGLLQDLAKAYDLYTEAAVSATKAMQGKLANKYYELAEQ
CV
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gacgatggtgttgagaacgaacatctggatgactcagcagaatggcagttcctcgagcct
ttgtgtgacatttctgtaagtgagtcggtaaaacagttaggtcatttgaattccttagat
aatagaaattatggacaattcgaacatgatcagcattcatctcatttatccgaaggaaat
cgagaattgatacatcgttggcaacaacttgcgaagtggtgtgcgaagcatccggatgac
ccgtggataaaattccgttttgataaattacctgtaagaaaatgtaaacgtcaccgttat
tcatctatacagcagtgctggaccgttgataatgtgcaagtgaaattgcatccggagcct
ttcgctcgaggtgcaatgcgcgagtgttatcgcttgaaaaagctcgtatcgcgtggtaaa
aatgatgattgggaccatgcacagaactatgttgccaaaaaatacataagaagtgttgat
aaagaagtgctgtttgaagatgtgaaattgcaaatggacagcaaactttgggctgaggaa
tttaatcgtcatcatccacccaagaagattgacatttttcaagtttgcattttggaattt
ctcgatgaagatgaacatacattttatcatcttgagcgtttcatagagggtgaatatatc
aaatataactccaattctggctttgtatcagatgtttgtcgtcagactcctcaggcattc
agtcactttacgtttgaacgtagcgggcatcagttgattgttgtcgatattcaaggagtg
ggagatttgtacaccgatccgcaaatacataccgcaactggagaaggttatggtagtgga
aatcttggtacaaaagggatggcattatttttccactcccatttttgcaacgacatttgt
cgatcaatgtgcttgacggagttcgatcttgctgaaagcgagagaaatgctctcaaggga
ggtggtaacgtcgaaaggaattggaattcagtgactagaagtagtagtaatagaccagca
agcatttgttcatcgcttgttgaagaaagaggtaatgctatggacgagctacgacgcaga
acagtatcagtgaacagctcgggaagacgttcttcagtatcttcgttttgtgatgaacaa
agcagtgatacacagtgttctgatgtgcgactttctaacgattgttttgagcaagttata
cgagactctgacaaacctatggctaaagcacaaatcaccagttctagttcctcaaattta
tgcgattcaactgatagtgagatgaaagaacgaatatatcacgatcctcagtttggaagt
ttgagtagctgcagttcgaaaatgactggacatattacccaggaagcagaaagagaagca
tactggttagaaaaacgcaaattttcacgaccggcggggctcttatcggaatcgcaaatc
aaagaactttctgaattctcgcaaaaaattcatggtataaattgcatccttggccagata
catttggatcttgcacgttatcatgaactgggacagtttgttgagaaatcggcttttgtt
tgttccgagaaagagaacgtttattcaacgaaagattacggatacaaaaaaagaaattgt
attggttacgacaaagatgcagctttctatcaccttgacattgctcggcgttgtggtgtt
cttgaagcgataatcactatggctaagatggcttttggtcagtctcacgagctcctgaaa
gaaatagtttgtggagaagtgtgggaaaatgaagatctagaagggactggtttcgaactt
atggaatgtgctgcagatatgggtgatcaatccgccgtcattttcgttgcacaagcgtat
gaaacgggtcgttttctcgggccaatgaaaaaaccgtcgtggccaaaagctgttgcttgg
tatgagaaagctttaaattttcttcaaagttcggaaacaaatgaaaatgaaacacctcat
gaaggtgtccgtcctcgttatgagttgctggagcgaatggcagttatgtatagagagggt
ggatatggcttgttgcaagacttagcgaaagcatatgatttgtatactgaagcggccgtg
tcagcaacaaaagctatgcaaggaaagctggcaaacaaatactatgaactggcagaacag
tgtgtataa

DBGET integrated database retrieval system