KEGG   Loa loa (eye worm): LOAG_05045Help
Entry
LOAG_05045        CDS       T02664                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
Organism
loa  Loa loa (eye worm)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 383 aa AA seqDB search
MAYMEQLLDVKFNLDNTPYKSIENIGTGAYGVVCKAYDQQNGKKVAIKKIMKAFSVAVLL
KRSLREIRILRCLNHENIVSVHDVFIAPGLHGLDVYMVLDLMETDLHQIIHSRQDLTNQH
YQYFLYQILRGLKYLHSVGIMHRDLKPSNLLVNSDCLLKIGDFGMARLAEQQLDDQNVLL
NPNFMTQYVSTRWYRAPELLFSLIDYDTQVDIWSAGCIFAEMLLRRQLFPGKDAGSQVKI
IIYYLGTPEKDVMERISSNIIIRWIESCGPKDPLPWTTIIPKANPQAVDLLKKLLIIAPW
KRITAEQALCHQYLETYHDTGSEPNCPKKVYFDAGEIERLSIDQLECALLAEASGPYTQQ
SSISSLERNENISQDSAPKENKQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatatggagcaattattggatgtgaaattcaatctggacaatactccgtacaaa
tcaattgaaaatattggtactggggcatatggagtggtatgcaaagcatatgatcagcaa
aatggtaaaaaagtagcaataaagaagataatgaaagcattctcagtagctgtccttctg
aaaagatcactacgtgaaatacgtatactacgatgcttaaatcatgaaaatattgtatcg
gtacatgatgtattcattgctccaggattacacggtctggatgtttacatggtacttgat
ttgatggaaactgacctgcatcaaataatacacagtcgacaggatcttactaatcaacat
tatcagtattttttgtaccagatattacgcggtctaaagtatttgcattcggtgggtata
atgcatcgtgatttaaaaccatcaaatttgctggtcaacagtgattgcttgctgaaaata
ggcgatttcgggatggctcgattagctgaacagcaattggatgatcaaaacgttttatta
aatcccaattttatgacccaatacgtctcaacaagatggtatagagctcctgagttgctt
ttctcacttattgattatgatacccaggtggatatttggtcagcgggttgcatattcgct
gaaatgcttcttcgtcggcaattatttccagggaaagatgctggaagccaagtcaaaatt
atcatttactatttgggcacaccggaaaaagatgtaatggaacgcattagctcgaatatc
atcattcgttggattgaaagttgtggaccaaaagatccgcttccatggactacaattata
ccgaaggcaaatcctcaagcagtggatctgctgaagaagctactgataatagcaccttgg
aaaagaataacagcagaacaagccttgtgccaccaatatttggagacttatcacgataca
ggaagtgaaccaaattgtccaaagaaagtgtatttcgacgcaggagaaatcgaaagacta
agtatcgatcagctggaatgtgcacttctcgcagaagcttcaggaccttatactcagcag
tccagcattagctcactggagcgtaatgaaaatatttcccaggactcagcaccgaaagaa
aataagcagtaa

DBGET integrated database retrieval system