KEGG   Loa loa (eye worm): LOAG_05045Help
Entry
LOAG_05045        CDS       T02664                                 

Definition
CMGC/MAPK protein kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    LOAG_05045
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_05045
Protein kinases [BR:loa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   LOAG_05045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 383 aa AA seqDB search
MAYMEQLLDVKFNLDNTPYKSIENIGTGAYGVVCKAYDQQNGKKVAIKKIMKAFSVAVLL
KRSLREIRILRCLNHENIVSVHDVFIAPGLHGLDVYMVLDLMETDLHQIIHSRQDLTNQH
YQYFLYQILRGLKYLHSVGIMHRDLKPSNLLVNSDCLLKIGDFGMARLAEQQLDDQNVLL
NPNFMTQYVSTRWYRAPELLFSLIDYDTQVDIWSAGCIFAEMLLRRQLFPGKDAGSQVKI
IIYYLGTPEKDVMERISSNIIIRWIESCGPKDPLPWTTIIPKANPQAVDLLKKLLIIAPW
KRITAEQALCHQYLETYHDTGSEPNCPKKVYFDAGEIERLSIDQLECALLAEASGPYTQQ
SSISSLERNENISQDSAPKENKQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatatggagcaattattggatgtgaaattcaatctggacaatactccgtacaaa
tcaattgaaaatattggtactggggcatatggagtggtatgcaaagcatatgatcagcaa
aatggtaaaaaagtagcaataaagaagataatgaaagcattctcagtagctgtccttctg
aaaagatcactacgtgaaatacgtatactacgatgcttaaatcatgaaaatattgtatcg
gtacatgatgtattcattgctccaggattacacggtctggatgtttacatggtacttgat
ttgatggaaactgacctgcatcaaataatacacagtcgacaggatcttactaatcaacat
tatcagtattttttgtaccagatattacgcggtctaaagtatttgcattcggtgggtata
atgcatcgtgatttaaaaccatcaaatttgctggtcaacagtgattgcttgctgaaaata
ggcgatttcgggatggctcgattagctgaacagcaattggatgatcaaaacgttttatta
aatcccaattttatgacccaatacgtctcaacaagatggtatagagctcctgagttgctt
ttctcacttattgattatgatacccaggtggatatttggtcagcgggttgcatattcgct
gaaatgcttcttcgtcggcaattatttccagggaaagatgctggaagccaagtcaaaatt
atcatttactatttgggcacaccggaaaaagatgtaatggaacgcattagctcgaatatc
atcattcgttggattgaaagttgtggaccaaaagatccgcttccatggactacaattata
ccgaaggcaaatcctcaagcagtggatctgctgaagaagctactgataatagcaccttgg
aaaagaataacagcagaacaagccttgtgccaccaatatttggagacttatcacgataca
ggaagtgaaccaaattgtccaaagaaagtgtatttcgacgcaggagaaatcgaaagacta
agtatcgatcagctggaatgtgcacttctcgcagaagcttcaggaccttatactcagcag
tccagcattagctcactggagcgtaatgaaaatatttcccaggactcagcaccgaaagaa
aataagcagtaa

DBGET integrated database retrieval system