KEGG   Loa loa (eye worm): LOAG_05318Help
Entry
LOAG_05318        CDS       T02664                                 

Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
loa  Loa loa (eye worm)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:loa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 464 aa AA seqDB search
MPMSVQDHSKRRVAYYYDANVGNYYYGQGHVMKPHRIRMTHHLLLNYGIYRNLEVYRPFP
ATFEEMTRFHTNEYMMFLRTATPDNLKQFNKQMLKFNVGEDCPVFDGLFEFCQLSCGGSL
AAAVKLNKRKADIAINWMGGLHHAKKSEASGFCYTNDIVLGILELLKYHKRVLYVDIDVH
HGDGVEEAFYTTDRVMTCSFHKYGDFFPGTGELKDIGAGRGKYYAVNVPLRDGITDESYQ
SIFVPVMERVMETFQPCAVVLQNGADSLNGDRLGTFNLTLRGHGACARFFRERHIPLMML
GGGGYTPRNVARCWTYETSIAVDMEVSDDLPYNDYFEYFGPHYRLHIDPSNANNENTPEF
LKKIQEGVMENLRHLPHVPSVQMQPIGDESFTEKCLNAEEADRDNANPDVRQHHTVLDAS
IEDQGEFYDNEKEGGDIRNEQSFKRSGSETETCDAEVAKKPKME
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgtcagtacaagatcacagtaaacgtcgtgttgcttattactatgatgcgaac
gttggaaattattattatggacaaggtcatgtgatgaagcctcatcgtattcgaatgact
catcatcttttactcaattacggtatctacagaaatctggaagtttatcgcccatttcca
gcaacatttgaagagatgacacgatttcatacaaatgaatacatgatgtttttgcgaacg
gctacaccggataacttgaaacagttcaataaacaaatgttgaaattcaatgttggtgaa
gattgtccagttttcgatggcttatttgagttttgtcagctctcttgtggtggttcttta
gcagctgcagtaaagctaaacaaacggaaagccgatatagcaataaactggatgggtggt
ttgcatcatgcaaaaaagagtgaagccagtggcttttgttacacaaatgatattgtcctg
ggcattcttgaacttctcaaatatcacaaaagagtactttacgttgacattgatgtgcat
catggtgatggtgttgaagaggctttctatactacggatcgagtgatgacgtgttctttt
cataaatatggtgattttttcccagggacgggagagttgaaagatatcggtgctggaaga
gggaaatattatgcagttaatgtacctttgagagatggtatcactgatgagtcgtatcag
agcatctttgttccggtcatggagagagttatggaaacattccagccgtgtgctgtagtt
ttgcagaacggagctgattctttgaatggcgatcgcttaggcacttttaatcttacttta
agaggtcatggtgcttgtgcccgattcttccgggagcgacacattccgctaatgatgttg
ggtggcggtggctacacgccaagaaatgtggctcggtgctggacttacgagacttcaatt
gctgttgatatggaagtctctgatgatcttccgtataacgattatttcgaatatttcgga
ccgcattatcgacttcatatcgatccctcaaatgctaataatgagaacacccctgaattc
ctaaagaagattcaagaaggagtaatggagaacttgcgacatttaccacatgttccaagt
gtgcaaatgcagccgatcggtgatgaatcttttaccgaaaaatgtcttaatgccgaagaa
gctgatcgtgacaatgctaatccggatgtccggcaacaccacactgtgttggatgcgtct
attgaagaccagggcgaattctacgataatgagaaagaaggaggtgatataagaaatgaa
cagtctttcaaacgttccggatcagaaactgagacttgcgatgctgaagtagcaaagaag
ccaaaaatggag

DBGET integrated database retrieval system