KEGG   Loa loa (eye worm): LOAG_05422Help
Entry
LOAG_05422        CDS       T02664                                 

Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
loa  Loa loa (eye worm)
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    LOAG_05422
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     LOAG_05422
Glycosyltransferases [BR:loa01003]
 Glycan extension
  Type 3 chain
   LOAG_05422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 414 aa AA seqDB search
MVLFAVVGRKMPLNVRLLSSGFYVLVGVIIGFSLSFLSLSGNQTVTSPMTGLIIKNPRRI
SSHFNDAHNEWEVDDNNAPTAAMYFHENGTSLHDDNNAMAKLLESKVRIFCWILTGKQNH
EKRARHVKATWSRRCSKYLFMSSETDPSLPSINLNITEGRDHLWAKTKAAFKYLHDFYLD
DYDWFLKADDDTYVILENLRFMLLAHDPNEPVWFGCKFKPFTKQGYMSGGAGYVLSRSAL
KKFVTEALPDSNKCKKSESGAEDAEIGKCLERVGVKAGDSRDAEGHHRFLPFVPEHHLMP
GHVDKKFWFWQYTYYPVEQGPECCSDYAISFHYVNPSLMYVLEYLIYHLRPFGITKNSLS
VIEAYRLAVKNMGPDDVFKKVFAPNKSVISVSRDSDILPKPSSKVETMAKKTDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggttttatttgctgtcgttggtagaaaaatgccacttaatgtacggttattatcatcc
ggattttatgtgttagtcggtgttatcatcgggttttctctgtcattcctgtctctatcg
ggtaaccagactgtgacttcaccgatgactgggctaataattaaaaatcctcggcggatt
tctagtcactttaatgatgctcataatgaatgggaagttgacgataataatgcaccaact
gctgcaatgtattttcatgaaaatggaaccagtctacatgatgataataatgctatggca
aaattattggaatcaaaggtgcgaatattctgttggatattgacgggtaagcaaaatcat
gagaaaagagcgaggcacgtgaaagcgacgtggagccgacgttgttcgaagtacctgttt
atgtcttccgaaacagatccatccttgccgtccataaatttgaacataacagaaggtcgt
gatcatttatgggccaaaacaaaagcagcatttaaatatttgcatgatttttaccttgac
gattatgactggtttttgaaagcggacgatgatacttatgttatcctggaaaatttgagg
ttcatgttattagcacatgacccaaatgaaccagtttggtttggctgtaaatttaagccc
ttcacaaaacagggttatatgagtggtggagctggttatgtgctctccagatcagccctt
aaaaaatttgtcaccgaggcacttccggattcgaacaagtgtaagaaaagtgaaagtggt
gcggaagatgcagaaattggaaaatgtttggagagagttggcgtaaaagcaggcgattcg
agagatgctgagggtcaccacaggttcctgccattcgtaccagaacatcatttaatgcca
ggacatgtagataagaaattttggttctggcaatatacatattatcctgtagaacagggt
ccagaatgttgtagtgattacgcaatatcgtttcattacgtaaatccttcattgatgtac
gttttggaatatcttatttatcatctacgacctttcggcatcacaaaaaattcgctatct
gtgatagaagcataccgtttggcggtgaagaatatgggcccagatgatgtgttcaaaaaa
gtatttgctccaaataaatcggtgatttcggtttcgcgggattccgacattctgccgaaa
ccatcatccaaagtggaaactatggcgaaaaaaacggataggtaa

DBGET integrated database retrieval system