KEGG   Loa loa (eye worm): LOAG_05448Help
Entry
LOAG_05448        CDS       T02664                                 

Definition
CBP-B
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    LOAG_05448
   04330 Notch signaling pathway
    LOAG_05448
   04350 TGF-beta signaling pathway
    LOAG_05448
   04630 Jak-STAT signaling pathway
    LOAG_05448
   04068 FoxO signaling pathway
    LOAG_05448
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_05448
Transcription factors [BR:loa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    LOAG_05448
Mitochondrial biogenesis [BR:loa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    LOAG_05448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1356 aa AA seqDB search
MPGPPNRTTPSFQPNTGTGTPQMNGLSTSISGNALTNGQVVTSGIKMEVPGDVTMGTEPS
GATDASGCCSKPGTSNIANAEKIKVSVSAIKTEIKTIKADGKGETKTEERKELPDKVFDA
NELRNNLKPVVDKLLSMEESIPFRIPVDPDILGIPDYFDIVKKPMDLSTVSRKLDTGEYK
NPWDFNDDMWLMFDNAWLYNRKNSKVYKYCNKLSEVFVEEINPVMQKMGYCCGQKLSFTP
LALFCYGQSMCTIARDQTYHVYETTSTQYGVTVSERYTYCTKCFEALPESGISLSENPND
TSNMVPKSKFVQMKNDQIDFEPFEKCIKCFRKWHRVCALFNKKVFPEGFICATCRREKNL
APAENRFTAKKLPHCQLSRFIEERVNKFMKNNPAGKDYEVIIRVLCAADKEVEVKPLMKQ
KYGPLGFPEKFPYRTKAIFAFEVIDGVEVCFFGLHVQEYGSNCPPPNKRRVYIAYLDSVH
FFQPRQLRTEVYHEILLGYLNYAMMLGYTMAHIWACPPSEGDDYIFHCHPPEQRIPKPKR
LQDWYKKMLDKGVGEHTVFDYKDIYKQARDENLVTPMELSYFEGDFWPNVIEDCIREAQN
EEQERKRQEEAARQEQQHAEDEDGDDMFHDGDNGKSKKNSKKKNNLKKGNSKNKKKVCSQ
TGNEVTDKLYINFEKHKEVFFTIRLMSPQSELSAQNNEIKDPDPLIASDLMDGRDTFLTR
ARDEHWEFSSLRRAKYSTICFCHALHNQEKSEGLSYTCNSCQGTAIWHCTTCEDFDLCNK
CYETMSHPHKLEKVSTLMEVEDKHDASNSRTESIQRCIQSLVHACQCRDANCRRSTCHKM
KRVVQHTKGCKKRQNANCAICKQLIALCCYHAKHCNGTSCQVPFCLNIRQKLQEQRRSQN
RRADMMMRRRMDMLSSGYGGTNTPGASQSSESAEFYDVHPSGPTAMNMSQTVAAHHGAGP
MQTYQGTGMTHMQHMQMGQPQSVMPSGQQQMTQMQQLQPHQYQTHGKGGVVQGSSQIHMM
GVPTTMQQSHTISQVQQQQAPHQQGVRMNMTSQMGGIQRPGMVGQMQHAQQPMNPPPYGR
GATQQNACGMSATAGPSSSYGGNTGQPMMLGQSMAQNSQSQPIMQQGMQNLRAKVYTGQP
IDRTALQQDPQVQAILTRFKNAERAEDKDKVLNDLKKMPHLFAAFIKMTSNERSGGDIPQ
SLNQQQLSAIQQQQQQHQQQQGMIRQPQMVTQQSGQWQQGTVSQQQYYQHQQSQVSQSGQ
QQPRGPGGQYASMSSQGQMAGTAMTQPQWQQQFQRNPQPVSPAMQSQFSQVRSPPVGRSP
SVSNVTQSAMMQPGATQPGVQQMQQGAVNQDQQPYR
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaccgccgaaccgaactacaccgtcattccaaccaaacaccggtaccggcaca
ccacaaatgaatgggctgtctacctctataagcggaaatgcactgacgaatggtcaggta
gtaacttcagggataaaaatggaagtgcctggtgatgtcacaatgggtaccgaaccatca
ggtgcgacagatgcctctggatgttgttcgaaacctggaacatcgaatatagcaaacgcg
gaaaagattaaagtttccgtaagtgcaattaagacggaaataaaaactatcaaagctgat
ggtaaaggcgaaacaaaaactgaagaaaggaaggaattacctgataaggtatttgacgcc
aatgaattacgaaataatttgaaacctgtcgtggataagcttcttagtatggaagaatca
ataccgttcaggattcctgttgatccggatattcttggcattccggattattttgatatt
gtcaaaaaacctatggatctatcaacagtaagccgaaaactggatacaggtgaatataag
aacccgtgggacttcaatgacgatatgtggttaatgttcgataatgcttggttgtataat
cggaagaattcaaaagtttataaatattgcaataagttgagtgaagtctttgtggaggaa
attaatcctgtaatgcaaaaaatgggttattgctgtggacaaaaattgtcgtttacaccg
ctggctttgttttgttatggccaatcaatgtgtaccattgcacgtgatcagacataccat
gtttatgagacaacatcaacccagtatggtgtgacagtttcggagcgttatacgtattgt
acgaaatgttttgaagctttaccggaaagtggcataagtttgagtgagaatccaaatgat
acatctaatatggtcccaaaatcgaaattcgtacaaatgaaaaacgatcagattgatttc
gagccatttgaaaaatgtataaagtgtttccgaaaatggcatcgagtatgcgcgcttttc
aacaagaaagtttttccagaaggattcatttgcgcgacatgtcgccgtgagaaaaatttg
gcgccggcagaaaatcgttttacagccaagaaattaccgcattgccaattgtcacgattc
attgaggaacgcgtcaacaaatttatgaagaataatcctgctggcaaagattatgaagtt
atcattcgtgtactttgtgcagctgacaaagaagtggaagtgaaacctttgatgaaacag
aagtacggacctcttggttttccggaaaaatttccatatcgaacaaaagcaatttttgct
ttcgaggtcattgatggtgttgaagtttgctttttcggtttgcatgtgcaggaatatgga
agtaattgtccaccaccaaataaaagacgagtatatatagcctacctggattcagtgcat
ttctttcaaccccgacagttacgtacagaagtataccacgagattttattgggttatcta
aattatgcaatgatgttgggttatacaatggctcacatttgggcatgtccaccatcagag
ggtgacgactacattttccactgtcatccaccagaacagcgaataccgaaacccaaacgc
cttcaagattggtataagaaaatgcttgataaaggtgttggcgagcatacggtttttgat
tacaaagatatatacaagcaagcacgagatgagaatttggtgacgccgatggaactgtcc
tatttcgaaggggatttttggcccaatgtaattgaagattgcattcgtgaagcacagaat
gaggaacaggaacgcaagcgtcaagaggaagcggcacgccaagaacaacaacatgctgag
gatgaagatggtgatgatatgtttcatgatggagataacgggaaaagtaaaaagaacagc
aaaaagaagaacaatttgaaaaagggtaactcgaagaacaagaaaaaggtttgttcacag
accggcaatgaagtcaccgataagttgtatataaacttcgagaaacataaggaagtcttc
tttactattcgacttatgagcccgcaatcggaattatcagcacaaaacaacgaaattaag
gatcccgatccattaatagcaagtgatcttatggatgggcgtgatacattcttaacacgt
gctcgtgatgaacactgggagttttcttcattacgacgcgccaaatattccacaatatgc
ttttgccatgcattgcacaatcaggaaaaaagcgaaggactttcgtacacttgcaatagt
tgccaaggaacagctatttggcattgtacaacttgtgaagatttcgatctttgcaacaaa
tgctatgaaacaatgtcgcatccgcacaagctggagaaagtcagtacactgatggaagtg
gaagataagcatgatgcaagcaattcacgaactgaaagtattcagcgctgcattcaatca
ctggtacacgcatgtcaatgtcgcgatgcaaattgtcgccgctcaacatgtcacaaaatg
aagcgtgttgtgcaacacaccaaaggttgcaaaaagcgccaaaatgcaaattgtgctatt
tgcaaacaactcattgctctgtgttgctatcatgccaagcattgcaacgggacttcatgc
caggttccattctgcttaaatattcgccagaaactacaagaacaacgaaggtcacagaat
cgtcgtgctgacatgatgatgcgtcgacgcatggatatgctttctagtggttatggtgga
accaacacaccaggtgcctcgcagtccagcgaatcagcggaattttatgatgtgcatcct
tcagggccaactgcgatgaatatgtctcagaccgtggcggctcatcatggtgctggacca
atgcagacctatcagggtacgggtatgacacatatgcagcacatgcaaatgggacaaccg
cagagcgtaatgccatccggccagcagcaaatgacacaaatgcagcagttacagccacat
cagtaccagacacatgggaaaggtggtgttgtgcaaggcagttcacaaatacatatgatg
ggtgtacccacaacaatgcagcaaagccatacaatatcacaagttcaacagcaacaggct
ccacatcagcaaggcgtacgcatgaatatgacatcacaaatgggtggaatacaaagaccc
ggaatggttggacaaatgcaacatgcacaacagccgatgaatcctccaccatatggacgt
ggtgctactcagcaaaacgcctgtggtatgtctgcaacagcaggaccatcctctagctac
ggaggtaataccggacaaccaatgatgcttggacagtccatggcgcagaattcacaatca
cagccaataatgcagcagggaatgcagaatttacgagcgaaagtttatactggacaaccg
atcgatcgtactgcgttacagcaagatcctcaggtacaagcaatattaacgaggtttaaa
aatgcagaacgagcggaagacaaagataaagtactgaatgatctgaagaaaatgcctcac
ctttttgctgctttcatcaaaatgacgagcaatgaaaggagtggtggagatatcccacaa
agtttaaatcaacaacaacttagtgccatacaacagcaacaacaacagcatcaacaacaa
cagggaatgataagacaacctcaaatggtaactcagcaaagtgggcagtggcaacaaggg
acagtttcacagcaacaatattaccaacatcagcaatcgcaggtgtcacaaagtggccaa
cagcaaccccgcggccccggtggtcagtatgcatcgatgagttcacagggtcaaatggcc
ggtactgcaatgacacaaccgcagtggcagcaacagttccaacggaacccacaacctgta
agcccagctatgcagtctcagttcagtcaggttcgttcaccacccgttggacgttctcca
tccgtcagcaatgtcacacaatcagcaatgatgcagcctggtgcgacgcagcctggtgta
cagcaaatgcagcaaggagcagttaatcaagatcagcaaccatacagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system