KEGG   Loa loa (eye worm): LOAG_06919Help
Entry
LOAG_06919        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_06919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1578 aa AA seqDB search
MRHVPQQFFLENEKRSADEIPTEKSSELKHLQDSLTRFFTPTNQRRSRVAQSSFSLESFE
PGASSSRATSCKCVDSKKHHFSAISIDTKHGDFQSHTSPQPSISSPLKSGQSTPSPHRRT
DALFDALSPYFSAASEKRRTFSKGQYVHLSGGRTRTKSGESSAVHEDSAFSSSCIRQPNT
SAAVTSSESQDELPSTEQRRNIIRPARKKRRSTHVIEPATSYQNSSSIYTRINEKAAVRH
SFQNASLYPVECVSRSSGLRHVSSNLKSLVPKGLVSQRRLRTASIIRKAKSHKTRLKLRQ
SLSPRLVTRKRVVSLRQPHLDELNMAGGTVSLAEPVTITNEDRELYNAARNLAGLDFDTT
SSGCTAGERKIFNDAIDNSRNPKAVRIGNFEIETWYSAPYPAEYAQLSILYLCEYCMKYM
KSLEMRQRHSERCQLRHPPGNEIYRKDGVSVFEVDGYCSRIYCQNICLLAKLFLDHKTLY
YDVEPFLFYVVTKNDSSGCHFVGYFSKEKYSAQKYNLSCIMTLPSYQRQGFGRFLIDFSF
LLSRKEGMTGTPERPLSDLGRFSYKSYWRSAICEYLYKTISPDKTKRLTLRGIARGTGIS
VYDVMETLQSLNMLQRINSQMVIILNMTMLKNHWTKAKNDTKRIWLDETKLSWLPVVHSP
SKEYGERSSHVLRSPFASPIRQTAMRRNRGSMLQNAGGGSGTQESKTNSDFFREKCIKNG
KTILKRQPSDDNTSDEDKKTIMDLKTTCRDGKQNRRIWRKTSGDDSDDDDVKLQKETRKN
MRLAEMSQKKMSKRSATNRRFRKSGTKKAVAIEPYTYPSSSNSDSSDLSDDSSDVRKNGK
AYKPSHRKHISRSHFKRRKQKSITNVESIELNNVNDQDIMPDNKGIPVKTMNSNCHKLHL
YHISSSADSSGSEGSSDDSLLILKRRRISNSTKPLFSSCANSPEPLRDGHITPKLSVSQK
TGNEILDCDKPIATDAQQSNKNEKSLELSVDNEDELPPTLEADGVDSRDKLVKEWDSLDK
SCCSGSSFPNGMPLLRVNIAGNDSAYEGEDEDVPPRLSPNFAPVESSDTSSPKELESTPS
LCQTLPSKSAPDLLVVSSPSKPHETVSNNAASRITSVTNTICEMVNLGGDAGSEGESEAE
QKELGGSHSNHRKNGKSEALPLRLETSALDRPPKAPAMLSLPNEEHEMGHTDEKSEVASI
GKDSSVETVEHAVFQSNSSCRQPSSILNQSPILPPNSIHSDLSSQSFVSPPCSLQKRNTS
DGSCRTPLSQIEASPGEVFIGSADRNSVRSNPATPHHLSTQSHPGSEMMFCTTTTGDMCL
TMMTETPVMANNTKSMVKPSTPAVLPSTTTQHHSHRRGSKKDQSRSSKNTSNVQRAQMFM
PPTPLPPYVLAAPSAGQSFMGPSQVTHSQTGSYYGGGYANSRHSAYFDSQFHPSALSAAT
ASATYPASSVSYPSHLGGIGKTYPMGAAVQSGFSYSYPRGMHQAGANVGLSSGSGTIGPV
TPQQMISVQCPELQSNGQANAAASWRYPTPSAAFSGHFMDAFGGGMPSAASGSQFALPNQ
LYYQHGYHPYLMPMMRND
NT seq 4737 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatgtcccgcagcagttttttctggaaaacgagaagagaagtgcggatgaaatt
ccgacagaaaaatcgagtgagctgaaacatctgcaggatagtttgacgcgatttttcact
cccaccaatcagaggcgctctagagttgcacagtcatcattctcattagaaagttttgaa
ccaggcgcttcatcatcacgagctacatcatgcaagtgcgtcgattcaaaaaagcatcac
ttttctgccatctccattgatacgaaacatggcgactttcagtcacatacttctccgcaa
ccttctataagttcacctttaaaatcggggcagtcaacaccatcgccgcatcgccgtacg
gatgcactttttgatgcgttgtctccgtattttagtgcagcctctgaaaagcgacggact
ttttcaaaaggacaatatgttcatctttccgggggccgtacaagaacaaaaagtggagag
agcagcgccgtccatgaagacagtgcgttttcctcaagttgtatacgtcaaccaaacacc
agcgcagctgtaacatcaagcgaatcacaagatgaacttcctagtactgaacaacgacgg
aatattatacgcccagcaagaaagaaacgccgttcgacacatgtaattgaaccagcgaca
tcatatcaaaattcatcgtcgatatatactcgaataaacgagaaagcagcagtgcgtcat
tcatttcagaatgcatctttgtatccggttgagtgtgtctcgcgaagttctggattacga
catgtgtcatccaatttgaaaagtttggtccccaaaggacttgtatcacaacggagactg
cggactgcttcgatcattcgaaaggccaagtcgcataaaacacggttgaaattacggcag
tcattatctcctcgtctagtgacaaggaaacgtgtggtatcacttcgtcagcctcatttg
gatgaattaaacatggcaggagggacggtttctttggcggaaccagtgactataaccaat
gaagatcgagaattatacaacgctgctcgtaatttagctggattggactttgacactacc
tccagtggctgcaccgcaggagagcgcaaaattttcaatgatgcgattgataattcacgg
aatccaaaagcagttcggattgggaattttgaaatcgaaacatggtattctgcaccatat
ccagcggaatatgcacaactatcaattttatatttgtgtgaatattgtatgaaatacatg
aaaagtttggaaatgaggcagagacactcggaacggtgtcaacttcgacatcctccaggc
aatgaaatatatcggaaggatggtgtttcggtatttgaggtagatggttactgttccaga
atttactgtcagaatatttgccttctggcgaagttgtttctggatcacaaaacactgtat
tatgatgtggaaccgttcttattctatgtggttacaaagaatgatagcagtggatgtcat
tttgttgggtatttttctaaggaaaaatacagtgcgcagaaatataatttgtcgtgcatc
atgacattgccttcctatcagagacaaggatttggaaggtttttgattgatttcagcttc
ttgttaagtcggaaagaaggcatgacagggacaccagaaagacctttgtcagatttgggt
cgtttttcttacaaaagttattggcgatcagctatatgtgaatatctttacaagactatt
tcacccgacaaaacaaaacggctgactttgaggggtattgcacgtggaacgggtatttcg
gtttacgatgttatggaaacgttacagtcattgaatatgcttcaacgaatcaattctcag
atggtaattatactgaatatgacaatgttgaagaatcactggacgaaagcaaagaacgac
acgaagcgtatttggttggatgaaacgaagctatcatggttaccagttgtacattcgcct
tcaaaggaatatggcgaacgatcatctcatgtgttacgctctccgtttgctagtcctatc
cggcaaactgcaatgcgacgtaatcgtggaagcatgttgcagaatgcaggtggtggtagt
ggtacgcaggaatccaaaacaaatagtgatttttttcgagagaaatgcatcaaaaatggt
aaaacaattctgaaaaggcaaccgtctgatgacaatacatcggatgaggacaagaagaca
ataatggatttgaaaactacatgtcgagatggaaagcagaacaggcgaatttggcgaaaa
acaagtggtgatgattctgatgatgatgacgtgaagttgcaaaaggaaacaaggaagaac
atgcgcttagcagaaatgagccaaaagaaaatgtcaaaaagaagtgcaaccaatcggcgt
ttccgaaaaagtgggacgaaaaaggctgtagcaattgaaccctatacttatccatcatca
tctaatagtgattcatcagatctaagcgatgatagttcggatgttcggaaaaatggaaaa
gcttacaagccttcccacaggaagcatatatcacgttctcattttaaacgacgaaagcag
aaaagtattaccaatgttgaatcaatcgaactaaataatgttaatgatcaagatattatg
ccagataataaaggaatacccgtgaaaaccatgaattcaaattgccataaactacatctt
tatcacatatcatctagcgctgattcaagtggttctgagggatcatccgatgactcactt
ttgattttgaaacgacgcagaatcagtaatagtacaaaaccgctgttttcaagctgcgca
aactctccagaaccattgagagatggacatataactcccaaattgagtgtgagtcaaaaa
acaggtaacgaaattcttgactgcgataagccgattgcaactgatgctcagcaatcaaac
aaaaatgaaaaaagtttggaattaagtgtcgataatgaagatgaactgccgcccacacta
gaagcggatggcgtcgacagcagagataaactagtaaaggaatgggacagcctggataaa
tcatgctgttccggaagcagttttccaaacgggatgccgcttctccgcgtgaatattgca
gggaatgacagtgcatatgagggagaagatgaagacgtcccgccaagattgtcgccaaac
tttgctccggttgaaagtagcgacacgagtagtccaaaagaactcgagtcaacaccatct
ttgtgccaaacactgcccagcaaatctgctcccgatctgctagttgtttcatcaccttcg
aagcctcatgaaacggtgtcgaataatgcagcgtcacggattacatctgttaccaacacc
atttgcgaaatggttaatttgggtggcgatgctggaagtgaaggcgaaagtgaggcagag
cagaaagaactaggtggtagtcattcgaaccatagaaagaatggaaaatcggaggcttta
ccacttaggcttgaaacatcggcgctggacagacctccgaaggctccggcaatgctttcg
ttgccaaacgaagaacatgagatggggcatacggacgaaaaaagcgaagtcgcatcgatc
gggaaagatagttccgtggaaacagttgagcatgcagtgttccagagcaacagcagttgt
cggcaaccaagctcaatccttaatcagtccccaattttgccaccgaactcgatccattca
gacctctcttcccaaagcttcgtatcacctccctgttctttgcaaaagcgcaatacatct
gatggctcctgtcgtactcctctttcacaaattgaggcaagtcctggcgaagttttcatt
ggttccgctgacaggaatagcgttcgctcgaaccccgcaactccacatcatttatcaacc
caaagccatccaggttctgaaatgatgttttgtactacaacgacgggcgacatgtgtctg
actatgatgactgaaacaccggtaatggcaaataacacaaaaagtatggtaaaaccgtcg
acgccggcagtgttaccatcaacgacaactcagcaccattcacatcgacgtggctctaag
aaagatcaaagtcgttcatcaaaaaacacttcgaacgtccagagagcacagatgtttatg
cctccaacgccacttccgccatatgtacttgcagcgccaagcgcaggacagtcatttatg
ggtccttcacaagtcacacattctcagacagggtcctactatggaggcggttatgcaaat
tcgcgacattccgcttacttcgattcacagtttcatccaagtgctttatcggcagcaacc
gcttcagcaacttatccagcatcgagtgtaagctatccatcccatttaggtggaataggt
aaaacatatcctatgggagctgctgttcagagtggtttttcgtattcttatcctcgtggt
atgcatcaggccggtgccaatgtggggctatcaagtggtagcggaaccattggaccagta
actccacagcaaatgatcagtgtacagtgtccagagttacagagcaatggtcaggctaac
gcagcagcttcatggagatatcctacgccgtcggccgcattttcgggtcattttatggac
gcatttggtggtggtatgccatcagcggctagtggtagtcagtttgcattaccaaatcag
ctttattatcaacatggatatcatccgtatttgatgccaatgatgcgaaatgactaa

DBGET integrated database retrieval system