KEGG   Loa loa (eye worm): LOAG_06995Help
Entry
LOAG_06995        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
loa  Loa loa (eye worm)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LOAG_06995
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LOAG_06995
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOAG_06995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 626 aa AA seqDB search
MSGNGSRPPRLDNLLKLDGYLWNYQNEICRRYGVFLDYSKKIEECGGWETFTTAYREYGV
VVMKDNSVRCLEWAPGAEALSLVGDFNDWNTESHPYKRLEYGKWELIIPADKDGNCPIKH
GSIIKVAVRKNNIFRFKLSPWAHYVTRPKEATVYHMPFYNPSESERYDFKHARPSKPESL
RIYEAHVGISSWEGKVNTYKNFANDVIPRIKNKVTSFFAASSRCGTPEDLKYLVDKAHEA
GILILLDVVHSHASKNVDDGLNEWDGTQNKYGFDGFRFDGVTSMLYHSHGIADALDGGYD
MYFGLNVDTDSLVYLMLANSFLHRRFPHIVTIAEEVSGMPALCRPVEEGGQGFDYRLAMA
APDLWIKFLKHFSDEDWDISNLVFTLENRRYAEKHIAYAESHDQALVGDKTIAFWLMDKE
MYDFMSETTPLTPIIERGIALHKMIRLITYGLGGEAWLNFIGNEFGHPEWLDFPRVGNNE
SFHYCRRQWNLVDNELLRYKYLNNFDRAMNELEEKHLFLSRGPAYTSWKHQDDKVIAFER
AGLLFIFNFHPHKSYSDYKIGIEVAGEYVLALNSDDSEFGGFNRLDKNQHYFTFPEGYAN
RRNHLCVYIPCRVAIVLEKISEKSAS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaacggtagcagacctcctcgacttgacaatttgctgaagttggatggatat
ctgtggaattatcagaatgaaatttgtcgtcgatatggagtattccttgactactcgaag
aaaattgaagagtgtggggggtgggaaacattcacaacagcttatcgagaatatggtgtt
gtggtgatgaaggataattcagttcgttgtctggaatgggcaccgggagcagaagccttg
tcgttggtgggagattttaacgattggaacactgaatcccatccatacaagagactggag
tatggcaaatgggaattaattattccagctgataaagatggtaattgccccattaagcat
ggatcgataatcaaggttgcagtaaggaaaaataacatatttcgttttaaactatcgcct
tgggctcactatgttacacggccaaaagaagcaacagtttaccatatgcctttttataat
ccgtcagaatcggaacgttatgatttcaaacatgcaaggccatcaaaaccagaatcgtta
cggatttacgaagcacatgttggaatatctagttgggaaggcaaagtcaatacctacaag
aatttcgcgaatgatgttattccaagaattaaaaacaaggtcactagtttctttgcggca
tcaagtcgttgcgggacaccggaagacttgaaatatcttgttgataaagcacacgaagcg
ggtatccttatcttgcttgatgtggtacactcgcatgcttcaaagaatgtggatgatgga
ttgaatgagtgggatggtactcaaaataaatacggctttgatggattccgatttgatggc
gtaacatcgatgctataccattctcatggaattgccgacgcattagatggtggttatgac
atgtatttcggtctgaatgttgataccgactcacttgtttatttgatgcttgcaaattcg
tttctgcatcgcagattcccccatatcgtgacgattgctgaagaagtaagtggcatgcca
gcattatgtcgaccagtcgaagaaggtggacaaggtttcgattatcgcttagcaatggca
gcaccggatttgtggattaaatttctcaaacatttctcagatgaagactgggatatttct
aatttggtatttacactggaaaatagaagatacgctgagaagcatattgcatatgcagaa
tcacacgatcaagcccttgttggtgataagacgatagcgttctggttgatggataaagaa
atgtacgatttcatgtctgaaacaacaccgttaaccccaataattgagcgtggtatagca
ttgcataaaatgattcgtcttatcacatatggattaggtggcgaagcatggttgaatttt
attggtaacgaatttggtcacccagaatggcttgattttccacgtgtgggtaacaacgaa
tcatttcattattgccgaagacagtggaatttagtagataatgagcttcttcgatacaaa
tatttaaataattttgatcgtgccatgaatgaattggaagagaagcatcttttcttatca
cgcgggccggcatacacttcgtggaaacatcaggatgataaagtgatagcattcgaacgt
gctggtcttctctttattttcaattttcatccgcacaagagttactcggattataaaatt
ggtatcgaagtagcgggggagtatgtactggcattaaatagtgatgactccgaatttggt
ggttttaatcgattggacaaaaatcagcattactttactttcccggaaggttatgcaaat
cgacggaatcatctttgtgtatatattccttgccgtgttgctattgtcttggaaaaaata
agcgaaaagtctgcttcctga

DBGET integrated database retrieval system