KEGG   Loa loa (eye worm): LOAG_07191Help
Entry
LOAG_07191        CDS       T02664                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_07191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 407 aa AA seqDB search
MAVSNIKEKYADFLVDGAQAVSLTFVSDMNKMASAQKHHPEYVYQHFGENETVFGYKDLN
VIIHYTDVSMYLYPEISYTAEITSFTTEFKADNIIRKLSEQLPAEQMEMLCQTSAIFKSR
LDDQRNFRPYGQLLFKFTAGNRELQVWVVNESSPEFDAYLARVQTLALWYIEAAQYTDND
DPRWQHYFLYESFKKDGISRVALAGYASLVRFYNYPDKIRPRIAQILLLPHYQGAGIGAR
FLKAIYNDLIQDPNVTDITAEVPAESFITTRDYVNCCYCLTLKEFSADNLKKGFTEEMKS
AALRFKINPKQARRVYEILRLRYIGVRDEKAMEEYRMDVKKRLEKPFKRSERDWRKLSSV
LDEYEYAAVVASQMSIEQKTAKLEQLYEEELAGYRTVIKRLINFANG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtcaaacataaaggagaaatatgccgactttctggtggatggtgctcaggca
gtatcattaacttttgtgtccgatatgaacaaaatggcttcggcgcaaaaacatcatccc
gaatatgtctaccagcacttcggagagaacgaaacagtatttggttacaaggacctaaat
gtcattatacattacaccgacgtgtctatgtatctctacccggaaattagttatacagcc
gaaataacatcgttcacaacggagttcaaagctgacaatataattcgaaaattaagcgaa
cagttgccagctgaacaaatggaaatgttatgccagacaagcgccattttcaagtctcgt
ttggatgatcagagaaattttcggccttatggacagcttcttttcaaattcaccgctggc
aatcgagagctgcaggtctgggtggttaatgaaagttcacctgaatttgatgcatattta
gctcgagttcagactcttgccttatggtacattgaagctgcacagtacacagataatgat
gatccacggtggcagcattatttcttgtacgaatcatttaagaaagatggaatttcgcgc
gtggcacttgcgggctatgcatcacttgtcagattttataattatccagataaaattcga
cctaggattgcccagattttactactgccacattatcaaggcgcaggtattggtgctaga
tttttgaaggcaatatataacgacttgatccaagatccaaatgttacagacattacagcg
gaagtccctgcagaatctttcataacaactcgagactacgtgaactgctgttattgctta
accctgaaggaattcagtgcagataatttaaaaaaaggtttcaccgaagagatgaagagt
gcagccttacggtttaaaataaatccaaaacaagcacggcgtgtttatgaaatactgcgt
ttgcgttatatcggtgtgcgagatgaaaaagccatggaagaataccgaatggatgtaaag
aaaagacttgagaaaccttttaaacgaagtgaacgtgactggaggaaactgtcaagcgtt
ttggatgagtatgaatatgcagcagttgtagccagtcagatgagtatagagcagaaaaca
gccaaattagaacaactctatgaagaagaactagccggttatcgcactgtcattaaacga
ttgatcaattttgctaatggttaa

DBGET integrated database retrieval system