KEGG   Loa loa (eye worm): LOAG_07562Help
Entry
LOAG_07562        CDS       T02664                                 

Definition
transcriptional regulator
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     LOAG_07562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 306 aa AA seqDB search
MAMSYAKALSPYENKGVLGLPEVVDDHHELKRKVSQLADLLLASRCCVLHTGAGISTAAG
IPDFRSPKGLWTLEARNEPIDDGVSFVEASPTYTHYGINALESKNIVKFVITQNVDGLHI
RSGYPLNRIAELHGNVFLEKCARCRRRYYRTVPTGSIGLKPTGKRCEGTNNGRPCRGMLH
DVCLDWEDPLPEEDLCAANEFARNADLSICMGTTLQITPAGDLPLLTKKNGGKMVIINLS
KTKHDQKADLVINGHVDDVMRMLMTTMDIVVIQNFNPNFVVPFSIHPLERFTKNRKRRKL
KQEKEE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagctatgcgaaagccttatcgccttacgagaataaaggtgttctcggacta
cccgaggttgtcgacgatcatcatgaactgaagcgaaaagtgagtcagcttgcagactta
cttttggcgagtcgttgttgcgtgctgcatacaggagctggtatcagtactgcagcaggt
ataccggatttccgcagtcccaagggattatggactctggaagcacgaaacgaaccgatc
gatgatggggtcagtttcgttgaagcttcgccaacctacactcattatggaattaatgca
ttggaaagtaaaaatatcgttaaatttgttattactcaaaatgtggacggtttgcatatt
cgttcaggatatccattgaatcgtatcgctgaacttcacggaaatgtattcctggaaaaa
tgtgctagatgtaggagaagatattatcggactgtaccaactggaagcatcggattaaaa
cctaccggaaaacgatgtgaaggtacaaataatggacgaccttgtcgtgggatgctgcac
gatgtttgcttggattgggaagatccactaccagaagaagatctttgtgcagcaaatgaa
tttgcaagaaatgccgacctcagcatttgtatgggtacaacactccaaataactcctgct
ggtgacctaccgcttctgaccaagaaaaatggtggcaaaatggtcatcattaatctttcg
aagacaaaacatgatcagaaagccgatctcgtaattaatgggcatgtggatgatgtcatg
agaatgctgatgactacaatggatatcgttgttatacagaattttaatcctaatttcgtt
gtgcctttttctatccatccactagaaaggtttacaaaaaataggaagcgacggaagctg
aagcaggaaaaggaggaataa

DBGET integrated database retrieval system