KEGG   Loa loa (eye worm): LOAG_08076Help
Entry
LOAG_08076        CDS       T02664                                 

Definition
hyaluronidase
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_08076
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     LOAG_08076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 688 aa AA seqDB search
MQTRSKTKAEKERRAAQFLCGIVEGFYGRPWTADQRRDLFARMKRLGMNTYIYAPKDDLK
HRAEWRQLYSSDEVELLQSLIQTARMENVTFVYALSPGIDIIYSSDKEIKALHDKSEQVR
CLGCDAFALLFDDIDMALNDADKKQFSSIVMAQLTVANALYEFLKCPHFFFCPTEYCESR
ANPSLEESGYLLTLGKKLVPDIHILWTGPRVVSREITIDHIRRVAAVLQRKPVVWDNLHA
NDYDPKRVFLGPFAGRPVRLKEEIAGILLNPNCRYEANFLPFYTLAEWNSCHADADVLEE
AESDAILEAGDVVPVATHIVENASPKRLYHPLKALDEGIKKWIEYFNAESSTNSHPSVSV
EVAEVDELNELKPSTSCVSLVTRELNGPDSRDNQTAIVYFSAENNSVVQTVNSMCSEYSE
PMDLVSVTKEDTKPSLETSYQSKGNIQEMLEVSSDISMDSSVHSDSEANVTGVDQVAIFV
DMFYLPFEHGRRGIQMLQEFSWLHENSYVMRRSNGQDIDDQKVQEFVSDEWKRRCEDFVK
LLRDVTRLYQHITQLPNRSVVQELFQYVYDAQGMASILEALVLWMADGHLNVAPIDCDCF
WRVGIPDVEPWTLSGGFLADLQKLLYSSANLADLFLLKTVLPLSLNCYTVRPYADEDMNN
FRYMWKIENEYASNVGILEEIKDERFFD
NT seq 2066 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacgctctaaaacaaaagctgagaaagagcgtcgtgcagcacagttcttgtgt
ggtatcgttgaaggattctatggacggccatggacggcagaccagcggagagatttattc
gctaggatgaaacgtctgggaatgaacacttacatttacgcaccaaaagacgatctgaag
catagagctgagtggagacagctgtacagttccgatgaagtagagttactgcaatctttg
atccaaacagcaaggatggaaaatgttacatttgtgtacgcgttgtctcctggaattgat
attatttattcaagcgacaaagaaatcaaagctctgcatgataaatctgaacaggtacgc
tgtttaggatgtgatgcttttgcgctactgttcgatgatattgatatggcattgaacgat
gccgacaaaaaacagttttcgtctattgttatggcccagttaactgttgctaatgctcta
tacgagtttttgaagtgtcctcatttctttttttgtcctacagagtattgcgaatcacga
gcgaatccgtcattggaagaatcgggctatttacttacgctgggtaaaaaactggttcct
gatatacatattttgtggacaggacctcgagtggtatcccgtgaaattacgatcgatcac
atccgacgtgtcgctgctgtgttacaaagaaaaccggtggtttgggataatttgcacgcc
aatgattatgaccctaagcgggtttttctgggaccatttgcagggaggcctgtacgactg
aaagaggagatcgcaggaattttactgaatccaaactgtcgttatgaagctaatttcttg
ccgttctatacattagcggaatggaatagctgtcatgcagatgctgatgttttggaagaa
gcggaatcagatgctatattagaggcgggtgatgtagttcctgttgcaacacacattgtt
gagaatgcttcgccgaaacgattatatcatccattaaaagctctagatgaaggtattaag
aaatggattgaatactttaacgctgagtcgtcaacaaattcacatccatctgtttctgtt
gaagtagctgaagttgatgaactcaacgaactgaagccatcaacaagctgtgtttctttg
gtcactcgagaattgaatggtccggatagtagagacaatcagacagcaattgtttacttc
agtgctgagaacaactcagtggtacagactgtgaattcgatgtgctctgaatacagcgag
ccaatggatctggtgtcggttaccaaggaggacacgaagccatcgttggagacatcatat
caaagcaagggaaatattcaggaaatgctggaagtttcatcagatatcagtatggatagc
agtgttcattccgattcggaagcaaatgtcactggagtggaccaggtagcaatctttgtc
gatatgttttatttacccttcgagcatggtcgccgcggcattcaaatgttgcaggagttt
tcttggcttcacgaaaactcatatgtaatgaggagaagtaatggtcaagatattgatgat
cagaaagtacaagaatttgtgagtgacgaatggaaacggcgatgcgaggattttgtcaaa
ctgttacgtgatgtaacgaggctttatcaacatatcacgcaacttcctaatcgtagcgtt
gttcaggaactatttcaatacgtttatgatgctcaaggtatggcttctattctggaagca
cttgttctttggatggctgatggacatttgaatgttgcacctattgactgtgattgcttt
tggcgtgtcggtattccggatgttgaaccatggactttgtctggcggtttcctggcagac
ttgcagaagcttctgtattcgagtgctaatttggcggacttattcctattgaagacagta
ttaccgctttctttaaactgctacacagttaggccttacgcagatgaagatatgaacaat
tttcgatacatgtggaaaattgaaaatgaatatgcttcaaacgtgggaattctagaggaa
atcaaagatgaacgtttttttgacaa

DBGET integrated database retrieval system