KEGG   Loa loa (eye worm): LOAG_08585Help
Entry
LOAG_08585        CDS       T02664                                 

Definition
CMGC/MAPK/ERK1 protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    LOAG_08585
   04012 ErbB signaling pathway
    LOAG_08585
   04350 TGF-beta signaling pathway
    LOAG_08585
   04068 FoxO signaling pathway
    LOAG_08585
   04150 mTOR signaling pathway
    LOAG_08585
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    LOAG_08585
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_08585
Protein kinases [BR:loa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LOAG_08585
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LOAG_08585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MTAAVEVQTKNGVEEVHGQVFEVGPRYMNLCYIGEGAYGMVVSALDTETHERVAIKKISP
FEHQTFCQRTLREIKILTKFKHENIINIQEIIRAPSVEQMKDIYIVQCLMETDLYKLLKT
QRLSNDHICYFLYQILRGLKYIHSANVIHRDLKPSNLLLNTTCDLKICDFGLARVTDPGH
DHTGVLTEYVATRWYRAPEIMLNSKGYTKSIDVWSIGCILAEMLSNRPLFPGKHYLDQLN
LILGVIGSPSQEDLQCIINEKARSYLLSLPHKIKQPWLRMYPNADPRALDLLDKMLTFNP
NKRISIEDALAHPYLEQYYDPNDEPICEEPFTYEIEYDDLPKETLKQLIFKETEDHYRRT
QVAKKVTLSEEVELDSGIGSAILSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcggtagaagtccaaacgaaaaatggtgttgaggaagtgcatgggcaagtt
ttcgaagttggaccacgttatatgaatctttgctatattggggaaggagcctacggaatg
gtggtatctgcactggacacagagacgcatgaacgtgtcgctatcaaaaaaatttcacca
ttcgagcatcaaacgttctgccaaaggacacttcgagaaatcaaaattttgactaaattt
aaacatgaaaatatcatcaacattcaggaaattatcagagcaccaagtgtggaacaaatg
aaagatatctacatagtgcagtgtctgatggagacagatttgtacaagttgctgaaaacc
caacgactttccaatgatcatatttgttattttttataccagatattgcgtggattgaaa
tatattcattctgcgaatgttattcatcgtgatctcaaaccatcgaatttgcttctcaat
actacttgcgatctcaaaatttgtgattttggccttgctcgagtaacagatcctgggcat
gaccatactggagtgctgactgaatatgtagcgactaggtggtatcgtgcacctgaaatt
atgttaaattcgaagggttatacgaaatcaattgatgtttggtcgattggttgtatctta
gccgagatgttaagtaaccgacctctttttcctgggaaacattatctggatcagttgaac
ttaatcctgggtgttattgggtcaccaagccaggaagatttacaatgcattatcaatgag
aaggctcggtcatatttgctttcattgcctcacaagataaagcaaccatggttacgaatg
tatccaaatgcagatccgcgtgcacttgatttattggataaaatgctaacttttaatccg
aacaaacgaataagtatcgaagatgcccttgcacatccatatctggaacaatattatgat
ccgaacgacgaacctatatgcgaagaaccgtttacttacgagatcgagtatgatgattta
ccaaaagaaacattgaagcagctgattttcaaagaaacagaagatcattataggcgaacg
caggtagcaaagaaagtaacgctatcggaggaagtagaattggattccggcattggttcc
gcaatcttaagttcttga

DBGET integrated database retrieval system