KEGG   Loa loa (eye worm): LOAG_08585Help
Entry
LOAG_08585        CDS       T02664                                 

Definition
(RefSeq) CMGC/MAPK/ERK1 protein kinase
Organism
loa  Loa loa (eye worm)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MTAAVEVQTKNGVEEVHGQVFEVGPRYMNLCYIGEGAYGMVVSALDTETHERVAIKKISP
FEHQTFCQRTLREIKILTKFKHENIINIQEIIRAPSVEQMKDIYIVQCLMETDLYKLLKT
QRLSNDHICYFLYQILRGLKYIHSANVIHRDLKPSNLLLNTTCDLKICDFGLARVTDPGH
DHTGVLTEYVATRWYRAPEIMLNSKGYTKSIDVWSIGCILAEMLSNRPLFPGKHYLDQLN
LILGVIGSPSQEDLQCIINEKARSYLLSLPHKIKQPWLRMYPNADPRALDLLDKMLTFNP
NKRISIEDALAHPYLEQYYDPNDEPICEEPFTYEIEYDDLPKETLKQLIFKETEDHYRRT
QVAKKVTLSEEVELDSGIGSAILSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcggtagaagtccaaacgaaaaatggtgttgaggaagtgcatgggcaagtt
ttcgaagttggaccacgttatatgaatctttgctatattggggaaggagcctacggaatg
gtggtatctgcactggacacagagacgcatgaacgtgtcgctatcaaaaaaatttcacca
ttcgagcatcaaacgttctgccaaaggacacttcgagaaatcaaaattttgactaaattt
aaacatgaaaatatcatcaacattcaggaaattatcagagcaccaagtgtggaacaaatg
aaagatatctacatagtgcagtgtctgatggagacagatttgtacaagttgctgaaaacc
caacgactttccaatgatcatatttgttattttttataccagatattgcgtggattgaaa
tatattcattctgcgaatgttattcatcgtgatctcaaaccatcgaatttgcttctcaat
actacttgcgatctcaaaatttgtgattttggccttgctcgagtaacagatcctgggcat
gaccatactggagtgctgactgaatatgtagcgactaggtggtatcgtgcacctgaaatt
atgttaaattcgaagggttatacgaaatcaattgatgtttggtcgattggttgtatctta
gccgagatgttaagtaaccgacctctttttcctgggaaacattatctggatcagttgaac
ttaatcctgggtgttattgggtcaccaagccaggaagatttacaatgcattatcaatgag
aaggctcggtcatatttgctttcattgcctcacaagataaagcaaccatggttacgaatg
tatccaaatgcagatccgcgtgcacttgatttattggataaaatgctaacttttaatccg
aacaaacgaataagtatcgaagatgcccttgcacatccatatctggaacaatattatgat
ccgaacgacgaacctatatgcgaagaaccgtttacttacgagatcgagtatgatgattta
ccaaaagaaacattgaagcagctgattttcaaagaaacagaagatcattataggcgaacg
caggtagcaaagaaagtaacgctatcggaggaagtagaattggattccggcattggttcc
gcaatcttaagttcttga

DBGET integrated database retrieval system