KEGG   Loa loa (eye worm): LOAG_08870Help
Entry
LOAG_08870        CDS       T02664                                 

Definition
histone acetyltransferase
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_08870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 449 aa AA seqDB search
MDSVERWPVESLVDGAKLGVRMTGDSEFREAEILSIRIMPERKYKFYVHYIDCNRRLDEW
VDDSALDLTNVRFPQKGGKAPKIQVDTATRSYTVRIHRLQTVRCLKKGSTRKRKVVGDAS
EVVKTEEAPVVPRPLSPFQADIKAPTQRGSMSIIGHSEDALTRIRNIEMVELGRYRIQPW
YFSPYPQELTTLPCIYLCEFCLKFVKSSTCLKRHMMKCHLKHPPGNEIYRSDKLSFFEID
GRKNKTYAQNLCLLAKLFLDHKTLYYDTDPFLFYILTEQDDRGFHIVGYFSKEKESAEEY
NVACILVLPPYQKKGYGRLLIEFSYELSKCEGKTGSPEKPLSDLGLLSYRSFWSQKIIEK
LVQHRERCDDGDQLYLSVNDLSEETSIRKEDIISTLQQLNLYKYYKGQYVIVLSNELLDA
YRRRQEKRQVRIDPSKLHFQPKDWSRRKI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggactcagtagaaagatggccagtggaaagtctagtcgatggagctaagctcggtgtt
cgcatgaccggagattcggaattccgtgaagcagaaattttatcgatacgtatcatgccg
gaacgaaaatataaattttatgttcattacattgactgtaatcgacgactggatgaatgg
gtcgatgactcagcattggatttaaccaacgttcgatttccacaaaaaggtggtaaagct
ccaaaaatacaagttgatacggctaccagaagttatacagttcgcatacatcgtctccag
accgtgaggtgcctaaaaaagggctcaacacgaaagaggaaagtggttggtgatgcgtcg
gaagttgtcaaaacagaagaagcacctgtggtaccacgcccattatcaccatttcaagcg
gatattaaagcaccaacacagcgtgggtcgatgtcaattattgggcatagtgaggatgcg
ttaacgcggattcgaaacattgaaatggttgaattgggacgctaccgtatacagccgtgg
tacttctcaccctatccacaggaacttaccacacttccttgcatttatctttgcgagttt
tgcttaaaatttgtcaaaagttccacgtgtcttaagcgacatatgatgaaatgtcattta
aagcatccaccaggcaatgaaatatatcggtctgataaattatcttttttcgaaattgat
ggaaggaagaataaaacttacgcgcaaaatctctgtttattggcaaagctcttcctggat
cacaagactctctattatgataccgatcctttcctcttctatattttaactgaacaggac
gatcgtggttttcatatcgttggatatttctcaaaggaaaaagaatcagcagaagaatat
aatgtagcatgtatattagttttgcctccttatcagaaaaaaggttatggaaggctttta
attgaattcagctatgaactatcaaaatgtgagggaaagactggatcacctgagaaaccg
ctttcggatttaggattgctgtcttatcgtagtttttggtcacaaaaaatcattgaaaag
ttggtgcaacatcgagagagatgcgatgatggtgatcagctctacttatcagttaatgat
ctcagtgaggaaacaagcatccggaaagaagacatcatatcaacattacaacagctgaac
ctgtacaagtactacaaaggacagtatgtcatcgttttaagtaatgaattgttggacgca
taccggagaaggcaagaaaagcgtcaagttcgaatcgatccatcgaagcttcattttcaa
cccaaagactggtcacgacgaaaaatttaa

DBGET integrated database retrieval system