KEGG   Loa loa (eye worm): LOAG_08908Help
Entry
LOAG_08908        CDS       T02664                                 

Definition
histone acetyltransferase MYST1
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_08908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MSKRSKKDRSLPPAILPPESLTPSTVLKVGETFIVLRRAPNKNGVTDERCLATVVEIREG
EQASTSSASTSTTINTVATTNLSSDDMDVRKVCTNLLNDVSGEDVPVEVDIATRKEQCKM
YYVHYDGMDRRLDEWVGRNRIVARANPNAFTSVLSVPSSLAGTLESGTLTRSQRRIHEEF
NHVQKSYEDMDATTAKLEKEHAEMTKVKNIDKIRYGDYEIDAWYVSPYPDEYSKAAILYI
CEYCLAYMRSEAEYCCHMLHYCDRRQPPGDEIYRDGNLSVYEVDGKANKAYCQCLCLLSK
LFLDHKTLFFDVETFLFYVLCEVDEVGAHVVGHFSKERLSANNLACIMVLPPFQRKGYGK
LLIQLSYELSSREGVIGTPEKPLSDLGKVSYRSYWWWILLEALDRLNIDDVTVSDLSSAS
GVAEDDIISTLQTMQLIKYWKGDHVVRMTRRLVEHCKSINMGRPPKLLLDPDLLRWWPKK
RRQISHRDRD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgttcaaaaaaagaccgttcattgccacctgcaatattgccgccagaatcg
ttaacaccatcaacagtactaaaagttggagaaacattcattgtgctacgtcgagcaccg
aacaagaatggtgttacagacgaacgctgccttgcaacggtagtggaaattcgtgaaggt
gaacaagcaagcacatcttcagcttctacttctacaactatcaacactgttgctactact
aatttatcatcggatgatatggatgtccgtaaggtttgcacaaatcttttaaacgatgtg
tcgggcgaagacgttccggtggaggtagatattgctacgaggaaagaacagtgtaaaatg
tattatgttcattacgatggcatggatagacgactggatgaatgggtggggagaaatcgc
attgtggcaagagcaaatccaaacgctttcacttctgttctgtcagtaccatcatctttg
gccggtacactagaaagtggaacgttaactcgaagtcagcggcggatacacgaagaattc
aatcatgtgcaaaaaagttacgaagatatggatgcaacaacggcaaagctagaaaaagag
catgcggagatgacaaaagtaaaaaatatcgataagatacgttacggtgattatgagata
gacgcttggtacgtctcgccatatccggatgaatatagtaaggcagcaatattgtacata
tgtgaatactgcttagcatatatgcgaagcgaagcggaatactgctgtcatatgttacat
tactgtgatcgacgacaacctccaggagacgaaatatatcgagatgggaatttatcagtt
tatgaagttgatgggaaagcaaataaggcttactgccaatgtctttgcttgctgtcgaaa
ttattcctggatcataaaacattattttttgatgttgaaactttcctattttatgttttg
tgtgaggttgatgaagtaggcgctcacgttgttggtcacttttctaaagaacggctttct
gcaaacaatcttgcatgcattatggttttgcctccatttcaacgaaaaggctacggaaaa
ttgcttatacaattgagttatgaattgtctagccgtgagggagtgattggaacgcccgaa
aaaccactatcggatttgggaaaagttagttaccgtagctattggtggtggatattattg
gaagcccttgacaggctgaatatcgatgatgtgacggtatcagacttgagttctgcttct
ggtgtggccgaagatgatataatctcaacgttacaaactatgcagttaattaaatattgg
aaaggagatcatgtcgtgcggatgacaagacgccttgttgaacattgtaaatcgattaat
atgggacgaccacccaagttacttcttgaccctgatcttctacgttggtggccaaagaaa
cggcgtcaaatcagtcatcgcgacagagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system