KEGG   Loa loa (eye worm): LOAG_09746Help
Entry
LOAG_09746        CDS       T02664                                 

Definition
succinate-ubiquinone oxidoreductase
Orthology
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
loa  Loa loa (eye worm)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LOAG_09746
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LOAG_09746
  Energy metabolism
   00190 Oxidative phosphorylation
    LOAG_09746
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LOAG_09746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 388 aa AA seqDB search
MIARAGLQNSDMEFVQFHPTGIYGAGCLITEGSRGEGGYLVNSEGERFMKKYAPNALDLA
SRDVVSRAITIEIMEGRGVGKNKDHIYLQLHHLPAKDLHAKLPGIMETAMIFAGVDAAKE
PIPVLPTVHYNMGGIPTNYMGQVLTYKPDKGDQLVPGLYACGETAAHSVHGANRLGANSL
LDLVVFGRACAIDILEKAKKSPEKIPELPKGAGELTIANVDKLRFARGDIPTAALRLKMQ
KTMQQHAAVFRRGDILKEGITKMEALFKEQKLLKTTDRGLVWNSDLAETLELQNLMLNAT
QTIVAAEARKESRGAHARDDFPTRIDEFDYSKPLDGQTKKPFDQHWRKHTIIEQNHETGK
INLLYRPVIDQTLDKNETDWVQPMIRSY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcgagctggactgcagaattccgatatggaatttgttcagtttcatccaacc
ggtatttatggtgcgggttgcctcatcactgaagggtctcgaggcgaaggtggctatttg
gtgaatagtgaaggtgaacgcttcatgaagaagtatgcaccgaatgctttagatctggct
tcacgagatgtcgtttcgcgggcgataacgatcgaaatcatggaaggtcgtggtgtcggg
aagaataaagatcatatttatttgcagctgcaccacttacctgcgaaagatttgcatgcc
aagttgccaggtattatggaaacggcaatgatctttgctggtgtagatgctgcaaaggaa
ccaatacccgtcttaccaacggttcattataacatgggcggcataccaacgaattatatg
ggacaagtcttaacgtataaacctgataaaggtgatcagctagtgccgggattatatgct
tgtggtgaaacagcagcacattcggtgcatggtgcgaatcgtctgggagctaattcattg
ctagatcttgtcgttttcggacgtgcttgtgctatcgatattctggagaaggctaagaaa
tcgcctgagaagattcctgaattaccgaaaggtgcgggagaattaaccattgcaaacgtc
gacaagttacgctttgccagaggtgatattcctaccgctgctttaagattgaaaatgcaa
aagacaatgcaacagcatgcagctgtattccgacgcggtgacattttgaaggaaggtatt
acaaagatggaggctctcttcaaggaacaaaaacttcttaaaacaacagatcgtggatta
gtgtggaattcggatcttgctgagacattagaactacagaatttaatgctaaatgcgacc
cagactattgttgctgcggaagctagaaaagaaagtcgtggagcacatgctcgagacgat
ttcccgacacgaatagatgagtttgattattcgaaaccgctagatggccaaactaagaaa
ccattcgatcagcactggcgtaagcatactatcatcgaacagaatcacgagactggaaag
attaatttgctttaccgaccggtaatcgaccagacgttggacaagaacgaaacagattgg
gttcaaccgatgatccgatcttattga

DBGET integrated database retrieval system