KEGG   Loa loa (eye worm): LOAG_10211Help
Entry
LOAG_10211        CDS       T02664                                 

Definition
diaphorase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
loa  Loa loa (eye worm)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LOAG_10211
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LOAG_10211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 318 aa AA seqDB search
MFSNESSIINVALITGSAIFLSSIALYHFLYWRKGIHCTFCPFSGFTRKKLTLVDSEAIY
PLALMQKEIVNHDTRRFRFKLPTNEHILGLPVGQHIHLSAKINGKLVVRPYTPVSSDDDK
GYVDLMVKIYFSNVHPKFPDGGKMTQYLEKMEIGETINFRGPSGLIVYEGNGSFAVKLTK
KAEPKSRMYKNIGMIAGGSGITPMLQIILAIVKVPEDPTKVSLIFANKDEADILLRDELD
RLAADHPTKFRVWYTVDQAKPDWIYSTGFVNAEMIQKHLPRPGNDTVILMCGPPPMIKFA
CIPSLDKLGYPESDRLIF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgaatgaaagcagtataattaacgtggcacttatcactggttctgccatattt
ctttcttcgatagcgctgtatcactttttatattggcggaaaggtatccattgcacattt
tgcccgttttctggttttactagaaagaaattaacccttgtggattcagaagcgatatat
cctttggctttaatgcaaaaagaaattgttaatcacgacacacgaagatttcgtttcaag
ctacccacgaatgaacacattcttggtttgcctgttggccaacatattcacctttctgct
aagataaacggaaagcttgttgttcgtccatatacgccggtttcatccgatgatgacaag
ggatatgtcgatttgatggttaagatttactttagtaacgttcatcccaagtttccggat
ggtggaaaaatgacgcagtatcttgagaaaatggagataggtgaaacaattaattttcgc
ggtccttcgggattaatcgtttatgaaggaaatggttcgtttgctgtgaaattaacgaaa
aaagcagaaccgaaaagtcgcatgtacaaaaatatcggtatgattgcaggtggtagtggt
atcacaccgatgctgcaaattatcttagcaattgtaaaggttccggaggaccctaccaag
gtgtcactgatttttgcaaacaaagatgaagccgatatattgcttagagatgagttagat
agattagcggcggatcacccgacgaaattccgtgtgtggtatacagtcgaccaggcaaag
cctgactggatatactcaacaggatttgtgaatgcagaaatgatccagaagcatttaccc
agacccggaaacgatacggtaatcttgatgtgtggcccaccaccaatgatcaagtttgcc
tgtataccaagcctcgataagttaggttatccagagagtgaccgtttgattttctaa

DBGET integrated database retrieval system