KEGG   Loa loa (eye worm): LOAG_11221Help
Entry
LOAG_11221        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LOAG_11221
Transfer RNA biogenesis [BR:loa03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    LOAG_11221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 543 aa AA seqDB search
MTAGEISRQESAKAVNEIIARLIKAHREGKDVDLNRLKSKVSSIFSLSRQPKLVEIIAAV
PVEHRNWLVPKLKAKPIRTASGIAIIAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYST
QSYTGYEPTSMRAIRARYNPFLQTRSRVTQLMQLGHDVDKVEFVVMGGTFMSLPDDYRDY
FIRNLHDALTGHTSNSVSEAVEFSERSRVKCIGITIETRPDYCLPKHLDEMLSYGCTRLE
IGVQSVYEDIARDTNRGHTVKAVCECFKMAKDTGYKVVIHMMPNLPNVGIERDMEQFIEL
FENPEFRPDGLKLYPTLVIRGTGLYELWRTGRYKSYPPEVLVDLTARILALVPPWTRVYR
VQRDIPMPLVTSGVQYGNLREHALARMKQLGTACRDVRTREVGIQEIHNKVRPYQVELIR
RDYVGNGGWETFLSYEDPEQDILVGLLRLRKCADKIHRSELKGGVSIVRELHVYGSVVPV
SARDPSKFQHQGFGQLLMEEAERIAKNEHCSKKLAVISGVGTRNYYRLVLSTLSGFLEIC
ETF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggggagatttctcgacaagagagcgcgaaagcagtgaatgagattattgct
cgcttaatcaaagcccatcgagagggaaaagacgtcgatttgaatcgtcttaaaagcaaa
gtttcgtcaatcttttcattaagtcgtcaaccgaagttagttgaaatcatcgctgcagtg
cctgtggaacataggaattggttagtgccgaaactgaaggctaagccaattcgaacagct
agtggcattgctattattgccgtcatgtgtaaacctcatcgttgtcctcacatcaatttt
acaggtaatatttgtgtatattgtcctggcggaccagattctgacttcgaatacagtacc
cagtcctacacgggttatgagccgacctcgatgcgagcaatccgtgcgcgctacaatcct
tttttgcaaacaagaagtcgagtaactcagctcatgcagctcggacatgatgttgacaaa
gtagaattcgtagtaatgggaggtactttcatgtcactaccagatgattatcgggattat
ttcattcgaaatcttcacgacgcattgactggtcatactagtaatagtgtgtctgaggca
gtagaattcagtgaacgaagccgagtgaaatgtattggcataacgatcgaaacgagacct
gattattgtttaccgaaacacttggatgaaatgttgagctatggttgtacaaggctagaa
attggtgttcaatcagtatacgaagatattgccagggacacgaatagaggccatactgtg
aaagcagtatgtgaatgttttaaaatggcgaaagacacaggttataaggtggtaatacat
atgatgcccaatctccctaatgttggaattgaacgagacatggaacaatttatcgagctt
tttgaaaacccggaatttcgaccagatggcctcaaattatatccaacgttggttattcgt
ggcactggcttatatgaattatggaggacgggacgttataaaagttatccaccagaggtt
ttggtagatttgacggcccgtattctggctttggttcctccgtggactcgtgtttatcgt
gtacaacgtgacataccaatgccgcttgtgactagtggagtgcagtatgggaatctccgt
gaacatgctcttgcacgtatgaagcagcttggtactgcatgtcgggatgttaggacgcgc
gaagttgggattcaggaaatacataacaaggtccgtccttatcaagttgagctgattcgt
agggactatgtcggtaatggtggatgggagacgtttctttcttacgaagatccagaacag
gatattttggttggcctgctaagattgcgaaagtgtgccgacaaaattcatcggtcggag
ttgaagggtggagtatcgatcgttcgtgagttgcatgtttatggctcggtagtgcccgta
tcagctcgagatccatccaaattccagcatcaaggattcggacaactgttaatggaagaa
gcagaacgaattgcgaaaaatgaacattgtagcaaaaaattagcagttatttctggtgta
ggtacaaggaattattatcggttagttttgtcaactttatcgggttttttggaaatatgt
gaaaccttctag

DBGET integrated database retrieval system