KEGG   Loa loa (eye worm): LOAG_11300Help
Entry
LOAG_11300        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     LOAG_11300
Peptidases [BR:loa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   LOAG_11300
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   LOAG_11300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 301 aa AA seqDB search
MLFLNFVRIPFQDFANLTHHGVNSLGRNFYLRGENGLRLGCWHILPSEIAVNYRDPVLNA
REMERLMATSDNPVIIYLHGNSFDRSQSSRCGLYNLLANMGFHVLALDYRGYGDSNGSPS
EHGLIEDAKEIFRYARSHSSSNNIYLWGHSMGTAIATAAAMQFSEKGSPPAGLILESPFN
NLNDAVTHHPYTIPFRWLPWFKKMVLESLDRSGLDMSTDYRITKVNCPVLILHAEDDHII
PLQLARKLRDSALAAKRDVTLKEFDASRNFYHKFIYLADELPEILRRFTEKCTLKTKEAQ
Q
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcctgaattttgtgaggataccattccaagattttgcaaatttaacacatcat
ggtgttaattcattgggaaggaatttttatttgcggggagaaaatggcttacgattggga
tgttggcacatattaccttctgagatagccgtgaattatcgagacccagtattaaatgcc
agagaaatggaacggctgatggcaacgtcagataatccggtaattatctatttacacggc
aattcatttgaccgatcacagtcaagtcgctgtggattgtataatttactggctaatatg
ggttttcatgtgctagctttagattatcgcggatatggcgattcaaatggttcaccaagt
gaacatggtttaattgaggatgcgaaggagatatttcgctatgcaagaagtcattccagt
tcaaataacatatatttatggggtcattcgatgggaacagcaattgctacagcagctgca
atgcaattcagtgaaaaaggatcaccaccagctggcttgatcctagaatcaccattcaat
aaccttaatgatgccgttactcatcatccatatacaataccattccgctggttgccttgg
tttaaaaaaatggtattagaatcattagacagatccggtctggacatgagcactgattat
cgcatcacaaaggtgaactgtccagtgttaatattacatgccgaagatgaccacatcatc
ccactgcaattggctcgtaaattgcgtgatagtgctttggctgccaagcgtgatgtgacc
ctgaaggaattcgatgcaagccgcaatttttaccacaaattcatttatttagctgatgag
ctacctgaaattctcaggcgatttacagaaaaatgtactttaaaaacgaaggaagcgcaa
cagtag

DBGET integrated database retrieval system