KEGG   Loa loa (eye worm): LOAG_11325Help
Entry
LOAG_11325        CDS       T02664                                 

Definition
carboxylesterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
loa  Loa loa (eye worm)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LOAG_11325
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     LOAG_11325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MKRANSWLSRMTYQNHTGSISRHTDKDDLLGCGRTMMHPYFATFYLFLLTAIETTYTSRI
SPKEEPVVRTKLGIIRGIQQQFGDTFVNAYLGIPFAQPPLGSRRFALPEMIKPWQGELEA
QKPARTCYITPDNQFPQFPGAEMWNPPNVHDEDCLALNMWVPQKHDGKVMVWIYGGGFYS
GSPSLDLYDGRVLASRQKTIIVNINYRLGPFGFLYFGDKSSIPGNMGLMDQQLALRWIYE
NIASFGGDPNKITLFGESAGAASVTAHFFAPESFRYFRRAVLMSGTIANSWAIKEKNMAL
QTSIFLAEKLNCTSGHNKHSDVNLIAECIRQASAANIQKAADAVGMDQTLPMTFPFVPVE
EDEHFFKGNLFTKLRMRDFTKNISVLVGSMKDEGTYWLPYYFLNPKMGFQFNHTISADDP
TNRALINRAQYTCSIQSFIPYFDGSQLVKHALLHAYEEVSLTVQFLLNR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagccaacagttggctatctcggatgacatatcaaaatcataccggttcaatt
tcgagacatacagataaggatgatttattaggatgtggacgaacgatgatgcacccgtac
tttgctactttttatctattcttgttgacagcaatagagacgacttataccagcaggata
tcacccaaagaggagcccgttgtccgcaccaaattaggcattattcgtggcatacagcag
caattcggtgatacatttgtaaatgcttacctcggaattccatttgcccaaccacctctt
ggtagtcgaagatttgcattacccgaaatgattaaaccctggcaaggcgaattggaagcc
cagaaacctgcccgaacatgttacattactccagacaaccaattcccgcaatttcctggt
gccgaaatgtggaatccaccaaatgtacacgatgaggattgtttggcgctgaatatgtgg
gtaccacagaaacatgacgggaaagtgatggtatggatttatggcggtggcttctattct
ggttcaccatcgttggatctttacgatggacgagtgcttgcgagtcgtcaaaagacaatt
atcgttaacattaattacaggctaggaccatttggttttttgtactttggcgataaatca
tcgatacctggtaatatgggcctaatggatcagcaacttgctttacgatggatttatgaa
aatatcgcctcatttggtggtgatccaaataagataacattgttcggagaaagcgcaggt
gcagcatccgtaacggctcattttttcgcacctgaaagttttcgttatttccgaagagca
gtactgatgagcggtacgatagccaattcatgggccataaaagagaagaatatggcacta
caaacatccatatttctggctgagaaattgaattgtacctctggacataacaaacattca
gatgttaacttgattgcagaatgcatcagacaagcatctgctgcaaatatacagaaagca
gcggacgctgttgggatggatcaaaccctaccaatgaccttcccatttgtgcctgtcgaa
gaagatgaacattttttcaagggtaacttatttacgaaattgcgaatgcgcgatttcacg
aagaatataagcgtattggtcggttcgatgaaagatgagggcacatactggttgccctat
tactttctcaatcctaaaatgggtttccaattcaatcacactatatcagctgatgatccc
accaatcgggccttaattaatagagcacaatacacatgttcaatccaatcatttatccct
tatttcgatggttcccaattagtgaagcatgcattgctgcacgcatatgaggaggtcagt
ctaactgttcaatttttattgaaccgataa

DBGET integrated database retrieval system