KEGG   Loa loa (eye worm): LOAG_11450Help
Entry
LOAG_11450        CDS       T02664                                 

Definition
glycerol 3 phosphate dehydrogenase
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
loa  Loa loa (eye worm)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LOAG_11450
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     LOAG_11450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 298 aa AA seqDB search
MGPRTPIKVTLVGSGNWGSAISLIVGKNVQKYKDVFDHQVRMWVYEEIINGRKLTEVINT
EHENIKYLPGKKLPPNVVAIPDLLTACKDGDILIFVIPHQFVDNVCTQLKGHLKEDALVV
SLIKGFMVQKKKGGIRLVTEEIRDLLGVDTAVLMGANLAPEVANEDFCEATIGCKDQKDR
WSILKKLFDTDNFKIALTEDANTVELCGGLKNIVACAAGFADGLGYGSNTKSAIIRLGLM
EITIFVELFYHGSNIRTFFESCGVADLIATCSAGRNRKICEAFVKTGKVSQLEVLDPF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgagaacaccaatcaaagtgacacttgttggctcaggcaactggggttcagcg
atttctctgatcgttggaaaaaatgtgcagaaatacaaggatgtgtttgatcaccaagta
cgcatgtgggtctatgaagagataatcaatgggaggaaacttaccgaagttatcaacacg
gaacatgagaatatcaaatatctgccaggcaaaaagctcccaccgaatgtggtggctata
ccagacctactgacagcttgcaaagatggtgatatacttatatttgtaattcctcatcag
tttgtggacaatgtttgcacacaactgaaaggtcatctaaaagaagacgcgcttgtagtt
tcacttataaagggtttcatggttcagaagaagaagggtggaattcgtctggttactgaa
gaaatccgtgatttattgggtgttgatacagctgttctgatgggtgcaaatttggctccc
gaagtggcaaatgaagatttttgtgaggccactattggttgtaaagatcaaaaggataga
tggtcgatactaaaaaagttgtttgatactgataatttcaagattgctctgacagaagat
gcaaacaccgtcgaattatgtggtggcctcaaaaatatcgtggcatgtgctgcaggcttt
gctgatggtcttggttatggaagtaatacaaaatcagcaattatccgtttgggacttatg
gaaattaccatttttgtcgaactgttttatcatggctcgaacattcggacattttttgaa
agttgtggtgtggctgatctcatagcaacgtgtagtgccggcaggaaccgtaaaatatgc
gaagcattcgttaaaacgggaaaagtgagtcaattggaagtactagatccattctaa

DBGET integrated database retrieval system