KEGG   Loa loa (eye worm): LOAG_11607Help
Entry
LOAG_11607        CDS       T02664                                 

Definition
histone deacetylase 11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
loa  Loa loa (eye worm)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 317 aa AA seqDB search
MFEERQTIRPSEASMDDLRVVHSSTYLSSLRCPCYVAKMVEITPVALLPPCIINKVLLKP
LRYHTDKLRTDCVKCIGAYSLKSALCCNAALFEVAQVDKCIFLSSFEGGTVLAAKLALTS
GWAINIGGGFHHASRSKGGGFCIYADITLALTFLFSSQLISKAVIVDLDAHQGNGHENDF
SGDSRVYILDMFNSRIYPYDLRARRAIKRSVHLHVGTQDAEYLSLLSSNLEDVLSEFRPD
IIVYNAGTDCLRGDPLGLLSISSKGIRKRDEIVFKMARDRHIPVVMLLSGGYMPHTHEVI
AKSILNLYDKNLLNVEL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagaaaggcaaacgataagaccatcagaagcaagtatggacgacctacgtgtt
gttcattcatccacctacttgtcatcattacgctgcccatgttatgttgcgaagatggtt
gaaattacacctgttgcacttctacctccatgtattatcaacaaagtcctcctgaaaccg
ttgcgatatcatactgataagctgcgcacggattgcgttaaatgcatcggtgcatattca
ttgaaaagtgcactttgttgtaatgctgcactgtttgaagttgcacaggtggacaaatgt
atttttctttcgtcatttgaaggcggtacagtactggcagccaagcttgcactaacatcc
ggttgggcaataaatattggtggtggtttccatcatgcaagtcgttcaaagggtggtggc
ttttgtatttatgccgatatcaccttggcactaacattcttattctccagtcagttgatt
tcaaaagcagtgattgttgatttagatgctcatcagggtaatggtcatgaaaatgatttc
agcggtgacagtcgtgtttatatattggatatgttcaatagtcgtatttatccgtatgat
ttgagagcaagacgtgctataaaaagatcagttcatcttcatgttggtacacaagatgca
gaatatctctctttgctttcgagtaaccttgaagatgtcctgagcgaatttcggcctgat
ataatcgtatataatgcagggactgattgtcttcgaggagatccacttggtttattgtcg
atatcttcgaagggaattcgaaagcgtgatgaaattgttttcaaaatggctcgtgacaga
catattccggttgtaatgctacttagtggtggatatatgccacatacgcatgaagtcatt
gccaagtcgatcctgaatttgtacgataaaaatttattaaatgtggaactataa

DBGET integrated database retrieval system