KEGG   Loa loa (eye worm): LOAG_12238Help
Entry
LOAG_12238        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     LOAG_12238
    1.3.1.94  polyprenol reductase
     LOAG_12238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 180 aa AA seqDB search
MGLLLYLTHVLRRLYECLYVSIFSDTKMNILHFLLGITFYPFNVCSQLSSFTFEKKTEIN
TLSILLYTILAVAIFVVQIQQHYCFVLLAQIRLRNGLNAKNVHTVPYGGLFEYCSSPHYF
LEIILYFLFTLIYQLSVPMLLCFLFVITNQTIAALLNHKWYQKHFHAYAESRKAFIPYIL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttttgctgtatctaacacacgtattacgacgtttgtatgaatgcctttacgtc
tcgattttttcggataccaaaatgaacattttacatttccttttaggaatcactttttat
ccatttaatgtgtgctcacaactttcatcgtttacctttgagaagaaaacagaaataaat
accttatcaatattactttatacgatattagctgtcgccatattcgtggttcaaatacaa
caacattattgctttgtccttcttgctcaaattcgtctgcgcaatggcttaaatgcgaag
aatgtacatacagtaccatatggtggcctttttgaatattgctcatctcctcattacttc
cttgaaattatactttatttcttatttacattaatttatcagttatcagtacctatgcta
ttgtgttttctatttgtaattacaaatcaaactattgctgctttattaaatcataaatgg
tatcaaaaacattttcatgcatacgccgaaagtcggaaagctttcataccgtatatttta
taa

DBGET integrated database retrieval system