KEGG   Loa loa (eye worm): LOAG_12277Help
Entry
LOAG_12277        CDS       T02664                                 

Definition
CMGC/MAPK/NMO protein kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
loa  Loa loa (eye worm)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:loa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    LOAG_12277
   04310 Wnt signaling pathway
    LOAG_12277
   04068 FoxO signaling pathway
    LOAG_12277
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LOAG_12277
Protein kinases [BR:loa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LOAG_12277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 217 aa AA seqDB search
MEQHDTQPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIRMLSSF
RHDNVLCMIDVIQPQNPHFFQELYVLTELMQSDLHKIIVSPQPLTTDHVKIFVYQILRGL
KYLHSANILHRDIKPGNLLVNSNCILKICDFGLARMWDPHEQLAMTHEVVTQYYRSPELL
MGARTYTGAVDVWSVGCIFAELLGRRILFQAHGPVEQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacatgatacacaacccgatcgtccaattggttatggcgcttttggtgtcgtc
tggtcagtaacagatccacgtagtggtaaacgtgtagcgctgaagaaaatgccaaatgtt
ttccagaatcttgcatcatgcaaacgtgtctttagagaaattcgtatgctatccagtttt
agacatgataatgtattgtgtatgatcgatgttatacaaccgcagaatcctcattttttt
caagaactttatgttttaacagaattaatgcaaagtgatttgcataaaattattgtctca
ccacaaccacttaccactgatcatgtaaaaatattcgtttatcaaattttaagaggatta
aaatatctacattcagcaaatattttacatcgtgatatcaagccaggcaatttgctagtg
aacagtaattgcattttgaagatttgtgattttggattagcaaggatgtgggatccacat
gaacagttagctatgactcatgaagttgtaacacagtattatcgttctccggaattatta
atgggtgcacgaacatatacaggagctgtagatgtatggtcagttggttgtatatttgct
gaattattaggaagacggatacttttccaagcacatggacctgttgaacag

DBGET integrated database retrieval system