KEGG   Loa loa (eye worm): LOAG_12874Help
Entry
LOAG_12874        CDS       T02664                                 

Definition
histone deacetylase 7A
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LOAG_12874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 616 aa AA seqDB search
MEGQTSQQLHTGSVQTPIALSSLHFEPYYIPSTMHAIHGTLQASDYQLRKVSSEPNLKMR
IRAKLLNKSAGPLQSQSSAFAFTQRTSQSDTPMDTDFGGSTSSADSPTTLLATSPHLMIP
SPSLPNLASPAQIPMDMSALLAQAMYSPFFSMPSLIASNTLQPSFSMVDSGLDSSSTSSE
GAARNLMKFDTRNQNTLLSVGGYPSLLKQQLRDLVLRRKSLVREEPEDEAALGAQLLLRL
QSGSVLSTQLKTGLVYDPAMARHQCFCGNNRNHVEHGERVQSIWSRLQERGLVEKCERVF
ARKAPLEMLRTVHAPTYVTFFAVSPTACLKMEPSQLPVKSFVQLSCGGIGVDSDTYFNDA
STQLAARIAVGSLAELALQVAESRLRNGFACIRPPGHHAEYNQAMGFCFLNNVAIAVKYL
QQRCAEQCSRIAIIDWDVHHGNGTQICFEADPSVLYLSLHRHDNGNFFPGTGAVTEVGVG
SGKGYTVNIPFSGEMMDDADYLAAWRVIVAPILNEFKPTFIIVSAGFDAACGHSQALGGY
NLSPQLFGYFTRQLMNYAGGRVVLALEGGYNLDTISDSAEECVKALCGGSPETTGKLSDK
ALNAFPKQSAQETIQK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtcaaacctcacagcagctgcatacaggctcagtacaaacaccgattgcactt
tcatcactacattttgaaccgtattacattccttccacaatgcatgccatacacggaaca
ttgcaagcatcggattatcaactgcgtaaagtgagcagtgaaccgaatttgaaaatgcga
attcgtgcaaaacttcttaataaaagtgctggcccattacagtctcaaagtagtgctttc
gcatttacacaacgaacctctcaaagcgatacaccaatggatactgattttggtggtagt
acatcttctgctgattcgcctactactctgctagccacatcaccccatttgatgatccct
tcaccatccttaccgaatcttgcttcaccagcacaaattccaatggatatgtcggcattg
cttgcacaggctatgtattcaccgttcttttcaatgccatcacttatcgcaagtaacacg
ttgcagccgtcgttctcaatggttgattcaggacttgattcaagtagcacatcaagtgag
ggagcagcacgtaacctgatgaaatttgatactcgaaatcaaaatacattgttatcagtt
ggtggttatccgtcactgctgaaacaacagttgcgtgatttagtacttagacgaaaatct
ttggttcgtgaagaaccggaagatgaagcagcgcttggggcgcaacttctgttacgtttg
caaagtggatcagtattgagtacgcagttgaaaacaggtttggtgtacgatccagcaatg
gcgaggcatcaatgtttttgtggtaataacaggaaccatgtggaacacggtgaacgtgta
caatcgatttggtcacggttgcaggaacgtggtttggttgagaaatgtgaacgagtattt
gcacgtaaagcaccactagaaatgctaagaaccgttcatgccccaacatatgttactttc
tttgctgtttcgcccacggcttgcctcaaaatggaaccctcgcagttgcctgtaaaaagt
ttcgtgcaactttcttgtggtggtatcggagtcgattcagacacatatttcaacgatgct
tcaacacagttagcagcacgcattgctgttggttctttagctgaactagcgttgcaggtg
gcagaatcaaggctgcgaaatggttttgcatgcataaggcctcctggacatcacgctgaa
tataaccaggcaatgggcttttgctttttgaacaatgttgcaattgccgttaaatatttg
cagcagcgatgtgctgagcagtgttcacgaatagcaataattgattgggatgttcaccac
ggcaacggtacgcagatttgctttgaagctgatccttcggtgctttatttatctcttcat
cgtcatgataatgggaacttttttccgggtactggagctgttactgaagtaggtgttgga
tcgggtaaaggttatacggtaaatataccattttcgggtgaaatgatggatgatgccgat
tacttagcggcatggcgtgttatcgttgcgcctatattaaatgagttcaaaccgacattc
atcattgtttcagctggcttcgatgccgcatgcggacattctcaggctcttggagggtac
aatttatctccacagttgtttggttattttacacgacagcttatgaattacgctggtgga
cgtgtcgtacttgccttagaaggtggctacaatcttgatactatatcagattcggccgaa
gaatgtgttaaggcattatgcggtggaagccctgagacgaccggaaaattgagtgataag
gctttgaatgcatttcctaaacaaagtgcacaggagacgatacaaaag

DBGET integrated database retrieval system