KEGG   Loa loa (eye worm): LOAG_12935Help
Entry
LOAG_12935        CDS       T02664                                 

Definition
(RefSeq) histone deacetylase
  KO
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LOAG_12935
Chromosome [BR:loa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     LOAG_12935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 523 aa AA seqDB search
MYCKNFVFSIRELRVTCKTVRLPLHDIKERKFQNSGLLNRCTHLKTRKADLEDLCLVHSR
TYVERIAATREMNLEELEKLASTFDDIYFNNYSYEVATISVGVALQAMEAVLSEGERKSS
SFAAIRPPGHHASCEKACGFCIFNNVAICAKKARALGVEKVLIVDWDVHAGQGTQYAIED
EPKIKLISIHRYEHGLFWPYLPESGISHRYKNTINVPLNTVGMGDSEYIAFIQHFVVPII
HDFMPGLILVSCGFDAGFGDPEGNMNVSPAGYYWMTKLVLDAATAIGSPLCMVLEGGYFI
DSLTYGVQFCIKALLGDPEPNIQLGLCNSDFLHSLHSAILFHASEFSSLQLLADVTCHIR
TRCFVPKITPIKTEYKYQKISDEHEDVYDTRGVYCRPAESVTQRLRQELEKIMSKSCDKK
NKETISLIFIEKANGENTEKEIEIEVKDLHRRAVADFMQLHILNTPCTELVLSEKNQMDE
LKYMQKNCDEDTTITIVEGLFKLFNHHHCLNFNHLLNFELDLA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtactgcaaaaattttgttttttcaataagagagcttagggtaacatgtaaaacggta
agactgcctttgcatgatatcaaagagcgcaaattccagaattcgggtctgctgaatcga
tgtacacatctgaagaccaggaaggctgatttggaagatctttgtttggttcatagccga
acgtatgttgaacgaattgctgcaacgcgcgagatgaatcttgaggagctcgaaaaactc
gcttcaacttttgatgatatatatttcaataattattcctacgaagtagctacgataagt
gttggtgttgcgttgcaagctatggaggctgttctttctgaaggagaaagaaagagttca
tcattcgcagcaatccgaccaccaggtcatcatgcatcatgtgaaaaagcatgcggtttt
tgcatatttaataatgtggctatttgtgctaagaaggcccgagcactcggtgtggaaaaa
gttttaatagttgactgggatgtccatgctggtcaagggacacaatatgctatagaggat
gaaccaaaaatcaagctgatatcaatccatcgttatgaacatggcttgttttggccctat
ttgcctgaaagtggtatatctcatagatataaaaatacgatcaatgtgcctttgaataca
gttggtatgggtgattcagaatatattgcatttatacaacattttgtcgttcctataatt
cacgattttatgcccggtttaattttggtatcatgtggatttgacgctggttttggtgat
ccagaaggaaatatgaatgtaagtcccgcaggatattactggatgacgaaattggttctc
gatgctgctaccgcaatcggatcaccattgtgcatggtactggaaggtggctattttatc
gattcgctcacatatggtgttcaattttgcataaaagctttgcttggtgatccagaacca
aatattcagttgggattgtgtaacagcgatttccttcactcactgcacagtgcaatttta
tttcatgcctctgagttctcaagtctccagttacttgctgacgttacttgtcatataaga
acccgttgttttgtcccaaaaataacgccaatcaagactgaatataagtatcaaaagata
tcggacgagcatgaagatgtatatgacacacggggtgtatattgtcgtccagcagaatca
gtgactcagcgtttacggcaggagcttgaaaaaattatgtctaagagttgcgataagaaa
aataaggaaacaatatcactgattttcattgagaaagcaaatggcgagaatactgaaaag
gagattgaaatagaagtgaaggatcttcatcgcagagcagttgccgattttatgcagcta
catattttaaatacaccgtgtacggaactcgtgttatcagaaaagaatcagatggatgaa
ctgaagtatatgcaaaagaattgtgacgaagacacgaccattactattgttgaaggtctt
tttaaattattcaaccatcatcattgtctaaactttaatcatttattaaattttgaatta
gacctggcgtag

DBGET integrated database retrieval system