KEGG   Loa loa (eye worm): LOAG_12935Help
Entry
LOAG_12935        CDS       T02664                                 

Definition
histone deacetylase
Orthology
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LOAG_12935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 465 aa AA seqDB search
MYCKNFVFSIRELRVTCKTVRLPLHDIKERKFQNSGLLNRCTHLKTRKADLEDLCLVHSR
TYVERIAATREMNLEELEKLASTFDDIYFNNYSYEVATISVGVALQAMEAVLSEGERKSS
SFAAIRPPGHHASCEKACGFCIFNNVAICAKKARALGVEKVLIVDWDVHAGQGTQYAIED
EPKIKLISIHRYEHGLFWPYLPESDKNTINVPLNTVGMGDSEYIAFIQHFVVPIIHDFMP
GLILVSCGFDAGFGDPEGNMNVSPAGYYWMTKLVLDAATAIGSPLCMVLEGGYFIDSLTY
GVQFCIKALLGDPEPNIQLGLCNSDFLHSLHSAILFHASEFSSLQLLADVTCHIRTRCFV
PKITPIKTEYKYQKISDEHEDVYDTRGVYCRPAESVTQRLRQELEKIMSKSCDKKNKETI
SLIFIEKANGENTEKEIEIEVKDLHRRAVADFMQLHVSVFLYFVK
NT seq 1396 nt NT seq  +upstreamnt  +downstreamnt
atgtactgcaaaaattttgttttttcaataagagagcttagggtaacatgtaaaacggta
agactgcctttgcatgatatcaaagagcgcaaattccagaattcgggtctgctgaatcga
tgtacacatctgaagaccaggaaggctgatttggaagatctttgtttggttcatagccga
acgtatgttgaacgaattgctgcaacgcgcgagatgaatcttgaggagctcgaaaaactc
gcttcaacttttgatgatatatatttcaataattattcctacgaagtagctacgataagt
gttggtgttgcgttgcaagctatggaggctgttctttctgaaggagaaagaaagagttca
tcattcgcagcaatccgaccaccaggtcatcatgcatcatgtgaaaaagcatgcggtttt
tgcatatttaataatgtggctatttgtgctaagaaggcccgagcactcggtgtggaaaaa
gttttaatagttgactgggatgtccatgctggtcaagggacacaatatgctatagaggat
gaaccaaaaatcaagctgatatcaatccatcgttatgaacatggcttgttttggccctat
ttgcctgaaagtgataaaaatacgatcaatgtgcctttgaatacagttggtatgggtgat
tcagaatatattgcatttatacaacattttgtcgttcctataattcacgattttatgccc
ggtttaattttggtatcatgtggatttgacgctggttttggtgatccagaaggaaatatg
aatgtaagtcccgcaggatattactggatgacgaaattggttctcgatgctgctaccgca
atcggatcaccattgtgcatggtactggaaggtggctattttatcgattcgctcacatat
ggtgttcaattttgcataaaagctttgcttggtgatccagaaccaaatattcagttggga
ttgtgtaacagcgatttccttcactcactgcacagtgcaattttatttcatgcctctgag
ttctcaagtctccagttacttgctgacgttacttgtcatataagaacccgttgttttgtc
ccaaaaataacgccaatcaagactgaatataagtatcaaaagatatcggacgagcatgaa
gatgtatatgacacacggggtgtatattgtcgtccagcagaatcagtgactcagcgttta
cggcaggagcttgaaaaaattatgtctaagagttgcgataagaaaaataaggaaacaata
tcactgattttcattgagaaagcaaatggcgagaatactgaaaaggagattgaaatagaa
gtgaaggatcttcatcgcagagcagttgccgattttatgcagctacatgtttccgttttt
ctttactttgtgaaac

DBGET integrated database retrieval system