KEGG   Loa loa (eye worm): LOAG_13624Help
Entry
LOAG_13624        CDS       T02664                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
loa  Loa loa (eye worm)
Pathway
loa00220  Arginine biosynthesis
loa00250  Alanine, aspartate and glutamate metabolism
loa01100  Metabolic pathways
loa01200  Carbon metabolism
loa01210  2-Oxocarboxylic acid metabolism
loa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LOAG_13624
   00220 Arginine biosynthesis
    LOAG_13624
Enzymes [BR:loa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LOAG_13624
Amino acid related enzymes [BR:loa01007]
 Aminotransferase (transaminase)
  Class I
   LOAG_13624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9951095
NCBI-ProteinID: XP_003149178
UniProt: A0A1S0TKJ3
AA seq 177 aa AA seqDB search
MGQKPISFIRQVLACVSDPSLINSVNYPSDVKQRAELLLSYCGGHSIGAYSHSNGIEIIR
KHVAEYITHRDNGIPSDPQHILLSAGASESIRNILKLFIDKDGRNRKKGVMIPIPQYPLY
SASIVEFGLGLVGYYLDESNNWALNIDELEHAYKESLNQFNTRVLCVINPGNPTGMH
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaaccgattagttttattcgtcaggttttggcatgtgtaagtgatccatcg
ttaataaattctgtcaattatccatcagatgttaaacagcgtgcagaattgctactcagt
tattgcggtggacatagtattggtgcttatagtcatagtaatggtattgaaattattcga
aaacatgtagcagaatatattactcatcgtgataatggtataccatcagatcctcaacat
atacttttatctgctggagcatcagaaagtatacgtaatattttaaaattattcattgat
aaagatggtagaaatagaaaaaagggtgtgatgatacccattccacaatatcctctctat
tctgcatcaattgttgaatttggtcttggattggtaggctattatttggatgaaagtaat
aattgggcattaaatattgatgaacttgaacatgcttacaaggaatctttaaatcaattt
aatactcgagtactttgtgttattaatcctggtaatccaacaggtatgcattaa

DBGET integrated database retrieval system