KEGG   Loa loa (eye worm): LOAG_13624Help
Entry
LOAG_13624        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
loa  Loa loa (eye worm)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LOAG_13624
   01210 2-Oxocarboxylic acid metabolism
    LOAG_13624
   01230 Biosynthesis of amino acids
    LOAG_13624
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LOAG_13624
Enzymes [BR:loa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LOAG_13624
Amino acid related enzymes [BR:loa01007]
 Aminotransferase (transaminase)
  Class I
   LOAG_13624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 177 aa AA seqDB search
MGQKPISFIRQVLACVSDPSLINSVNYPSDVKQRAELLLSYCGGHSIGAYSHSNGIEIIR
KHVAEYITHRDNGIPSDPQHILLSAGASESIRNILKLFIDKDGRNRKKGVMIPIPQYPLY
SASIVEFGLGLVGYYLDESNNWALNIDELEHAYKESLNQFNTRVLCVINPGNPTGMH
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaaccgattagttttattcgtcaggttttggcatgtgtaagtgatccatcg
ttaataaattctgtcaattatccatcagatgttaaacagcgtgcagaattgctactcagt
tattgcggtggacatagtattggtgcttatagtcatagtaatggtattgaaattattcga
aaacatgtagcagaatatattactcatcgtgataatggtataccatcagatcctcaacat
atacttttatctgctggagcatcagaaagtatacgtaatattttaaaattattcattgat
aaagatggtagaaatagaaaaaagggtgtgatgatacccattccacaatatcctctctat
tctgcatcaattgttgaatttggtcttggattggtaggctattatttggatgaaagtaat
aattgggcattaaatattgatgaacttgaacatgcttacaaggaatctttaaatcaattt
aatactcgagtactttgtgttattaatcctggtaatccaacaggtatgcattaa

DBGET integrated database retrieval system