KEGG   Loa loa (eye worm): LOAG_14851Help
Entry
LOAG_14851        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
loa  Loa loa (eye worm)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LOAG_14851
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     LOAG_14851
Glycosyltransferases [BR:loa01003]
 Polysaccharide
  Storage polysaccharide
   LOAG_14851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 247 aa AA seqDB search
MSGSTTPQRRLSRRLTHTKIVRELLALENATVAEMDHGEKARREGRFVFECSWEVANKVG
GIYTVLRTKASVTTEELGDQYCMLGPYKEERVKLEVEILQPDSSPLKYAMDQLNDLGLKA
TYGRWLIDGYPKVVLFDIGSAAWKLDQWKQELWDSCKIGIPYHDSESNDAVILGFMVAIF
IQKYLYAIEGYQPLYVAHFHEWQAGIGLILSRLWKTDVSTIFTTHATLLGRYLCASGADL
YNNIDKV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggatcgacaacacctcaaagacgtttgtcacgtagacttacgcatacaaaaatt
gtcagggaacttttggccttagaaaatgctacagttgctgaaatggatcatggcgaaaaa
gcacgtcgagaaggtcgctttgtttttgaatgctcctgggaagtggctaacaaagttggt
ggaatatatacagtgttacgaacaaaagcatcggtgacaactgaagaattaggcgatcaa
tactgcatgttgggtccatacaaggaagaacgagttaagttagaagttgaaattttacaa
cctgattcatcgccattgaaatatgctatggatcaattaaatgatcttggccttaaggct
acttatggtagatggctaattgatggttacccaaaagtggtactgttcgatataggttcg
gctgcttggaaacttgatcagtggaaacaagagctatgggattcgtgtaaaatcggtata
ccatatcatgatagcgaatcgaatgatgctgtcatattgggttttatggttgcaatattc
atccaaaagtatttatacgcgatcgaaggttatcaaccactgtacgtagctcattttcat
gaatggcaagctggtattggtcttattttatccaggctatggaagacggatgtttcgaca
atttttacaacacatgctaccttacttggccgatacctatgtgcatccggtgcagatcta
tacaacaatattgataaagtttga

DBGET integrated database retrieval system