KEGG   Loa loa (eye worm): LOAG_15067Help
Entry
LOAG_15067        CDS       T02664                                 

Definition
choline Kinase A
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
loa  Loa loa (eye worm)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LOAG_15067
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     LOAG_15067
    2.7.1.82  ethanolamine kinase
     LOAG_15067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 164 aa AA seqDB search
LLGPRLFAVFPSGRFEQYIPSRPFITKYLGKVYARIHMLNVPIAKKPVIIDIANGWLQKL
GNKLRHKMRLKMVQADLSKKKKQKINIFPCPEIVTCAVLKNELEIVQQCLEKSGSPIVFC
HNDLQEGNILLHNQYSINENGDFDINENEDPISPIDFEYASYNY
NT seq 493 nt NT seq  +upstreamnt  +downstreamnt
attgcttgggccacgactttttgctgtttttccatctggtcgattcgaacagtatattcc
atcacgaccattcattaccaaatatttgggaaaggtatatgctcgaattcatatgcttaa
tgtacctattgctaaaaaaccagtaattattgatatagcaaatggatggttgcaaaagtt
aggcaataaattgcgccataaaatgaggcttaaaatggtgcaagctgatctttcaaagaa
aaaaaaacaaaaaataaatatatttccgtgtcccgagattgtaacatgtgcagttttgaa
aaatgaattagaaattgtccaacaatgtttggagaaaagtggaagtccaattgtattctg
tcacaacgatcttcaggagggtaatatattgctacacaatcaatatagtattaatgagaa
tggtgattttgatataaacgaaaatgaggatccaatttcaccaattgattttgaatatgc
tagctataattac

DBGET integrated database retrieval system