KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00415Help
Entry
lpa_00415         CDS       T01232                                 

Definition
heavy metal transporting P-type ATPase, cation transporting
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(316931..319489)
Genome map
AA seq 852 aa AA seqDB search
MLYSNYRFYLAKDAQLLNPEESREAIEQILAKTKELELIRVAVDLTSPNKSICLLSASKE
SHVIKTKVTQILKEQGLSIIDMMEVEVLQDIEKIEHHHPTHKSKDTHLHPIKKHPKKAKH
DHSHGHGHHHGHHHENHWIKAALGLIWGIGLLVLSIGTFNIPLVAYYVITGLTSLMTLYL
GHTVYQSAWQALKEKKWDTTTLYSISTLTILAVSIASVFVPGLPMMFEAAPLVLGFWHLG
EGIEHTLVGKINKKLDVRDCVPPLVLLKGNPDKEISVKTLIPNDMIIVKKGQVIPVDGVL
TQKALLYTTRIDGSPKLKEFHPGDVVKAGMQLADHIPSLEMQVTKTYQNSYLSLIAENIN
KANDEKAPIEMFANKVLKYFIPGLIAVALLSGIVIGSLFNPALAIQCVVSVLVSACPCAL
SLITPMAVKIGMKKASENGIHFNNGKALQAAADIDTVVFDLNGTLTQGKMVVKSLHITDK
KYLRPIALLESQSDHPVAKIIKSYIEQQDTVSTEPLEIASIDKSHHSGMKGIINGEAFMI
GNKDMLAANGITSIDKPYDNPEKGSVYIVRGTTVIGQIALIDPLREDAIATVKQLKRLGK
SVHICTGADQATAEKYAALLGIPKDNICANTVGAVTKKGEVSKTSYIQQLKQKGFKVAMV
GDAANDATAIAYSDIGIAVKSSIGDSITEQHAGIVVQQGLLFPIATAFDVAQKTKQNIFQ
NLFVSLSYNSIITLVAAGLFVALGFALNPVLGVALMVLESTIVLTNLYLFKQQDIVSSTS
SNANNAVEVEPTVNTTSKVLHALGHRSQPQENLAIVTESKLVNPKVINLFAPKELSSNRP
DVTQQKLGCVTC
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatagtaattatcgattctaccttgcaaaagatgcccaacttctcaacccggaa
gaatccagagaagcaattgagcagattttggctaaaactaaagagttggagttaataaga
gtagctgtcgatttgactagtccaaataaaagcatctgcttattgagcgcatccaaagag
agtcatgtcataaaaaccaaagtgacccagattttaaaggagcaaggcctttctataata
gacatgatggaagtagaagtactccaggatattgaaaaaatagagcatcaccatcctact
cataagtctaaggacacacatcttcatcccattaaaaagcacccaaaaaaagcgaaacat
gaccattctcatgggcatgggcaccaccatggacatcatcatgaaaatcattggatcaaa
gcagcattaggtttgatttggggaattggattacttgttctttctattgggacttttaat
attcccctggttgcttactatgtcattacaggacttacctctttgatgactttgtatttg
ggccatacagtttatcaatcagcctggcaagcattgaaagaaaaaaaatgggacaccact
accttatactcaattagcactctcactattcttgctgtttctattgcgagcgtttttgtc
cctggcctacccatgatgtttgaggcagcccctctggttttaggcttttggcatttaggt
gaaggaattgaacatactctggtcggtaaaatcaataaaaaattggatgtccgggattgt
gtaccaccattagtcctgttaaaaggtaatccggataaagagatttcagtcaagacatta
attcctaacgacatgattatcgttaaaaaaggacaggtcattcctgttgatggtgtctta
acgcaaaaagcgctcctttataccacaagaattgatggctcgcccaaactcaaagaattt
caccctggcgatgttgtaaaagctggcatgcaattggcagatcatattccttctctggaa
atgcaggttaccaaaacttatcaaaattcttatctgtcattgattgccgaaaacattaat
aaagcgaatgatgagaaagcgcctatcgaaatgtttgcaaacaaggtattgaaatatttt
atccctggtttgattgcggtagcgcttctatcggggattgtcatcggttcgttgtttaac
ccggcactggctattcaatgcgtcgtgtctgttctggtaagtgcctgcccgtgcgctttg
agtttaattaccccaatggcagttaaaatcggtatgaaaaaagcctctgaaaacggcatc
cactttaacaacggtaaagccttgcaagcagcagccgacattgataccgttgtttttgat
ttaaatggcactctgactcagggcaaaatggtggtgaaatcattgcatattaccgataaa
aagtatttgcgccctattgcattactggaaagccagtcggatcatccggtagcgaaaatt
attaaatcttacatagaacagcaagacacggtttcaaccgaaccattagaaatagcctcc
attgacaaaagccatcattctggcatgaaaggtattattaatggtgaggcctttatgata
gggaataaagacatgcttgcagccaatggaattacctctatcgacaaaccctatgataat
cctgaaaaaggctctgtttatattgtgcgcgggacaacggtgataggacaaattgcctta
attgatccattgcgagaggatgccattgctacagtgaagcaattgaaacgtcttggtaaa
tccgtacatatttgcaccggggcagatcaggctactgcagaaaaatatgcggcattatta
ggcattcccaaagataatatctgtgcgaacactgtgggggctgtcacgaaaaagggggaa
gtatccaaaaccagttatattcaacaattaaagcaaaaaggctttaaagtagctatggtt
ggtgatgccgctaatgacgctaccgcaattgcctattccgatataggcattgctgttaaa
tcaagtatcggcgactccataaccgaacaacatgccggcatagtcgtacaacaagggtta
ttatttcctatagcaacagcatttgatgtagcccaaaaaaccaaacaaaatattttccaa
aacctgttcgtgagcctaagctataactcaataattacgcttgtggcagcggggttgttt
gtggcattaggttttgcactaaatcctgtgctgggtgtcgcattgatggtacttgaatcc
actattgttttgacgaacttataccttttcaagcaacaagacattgtatcctcaacatca
tccaatgctaataatgctgtagaggtcgagcccactgtcaatacaacctcaaaagtcttg
catgctttagggcatcgttcccagcctcaagaaaatttagcaattgtgacagagtctaaa
ctagtcaatcccaaagtaataaatttgtttgcgcctaaagaactttcttctaatagacct
gatgtcactcaacaaaaattggggtgtgtaacctgttga

DBGET integrated database retrieval system