KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00470Help
Entry
lpa_00470         CDS       T01232                                 

Definition
bifunctional pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    lpa_00470
Enzymes [BR:lpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     lpa_00470
    3.5.1.-  
     lpa_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368949..369569
Genome map
AA seq 206 aa AA seqDB search
MKTLIILDVQNDFMPGGSLGVPNGDAIVPVINSILHCFDLIVASQDWHPSNHISFASNHP
GKKSFEKIKLGNLEQALWPDHCVQGSIGAQFHAQLNTNPIEAIFRKGTDPNIDSYSGFYD
NLHKKTTGLAGYLREKGARELYFCGLCADICVYFTIKDALSQGFDCYLIEDATQALVKDD
FIKIKKELIKQGTNIINSSNLLNNLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttaatcatcctcgatgttcaaaatgatttcatgccaggcggctcactgggg
gtaccgaatggtgatgcgattgttcccgttattaacagcattttgcattgttttgatctg
attgttgcttcacaggattggcatccttctaatcacattagtttcgcctccaatcatcct
ggtaagaaatcttttgaaaaaatcaagctggggaatttagaacaagctttatggccagat
cattgtgttcagggtagtattggagcgcaatttcatgcgcaattaaatactaatcctatt
gaagctatttttcgaaaaggaactgaccccaatatagatagctacagtggtttttatgac
aatttgcacaaaaaaaccacaggacttgccggttatctgcgcgaaaaaggcgctagagaa
ctttatttttgtggtttgtgcgctgatatttgtgtttattttacaattaaggatgccctc
agccagggatttgattgctatttgattgaggatgcaactcaagcgcttgtgaaggatgat
ttcataaaaataaaaaaagaattgataaaacaaggcactaacataattaacagttcaaat
ttgcttaataatttacaataa

DBGET integrated database retrieval system