KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00657Help
Entry
lpa_00657         CDS       T01232                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lpa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(509502..510785)
Genome map
AA seq 427 aa AA seqDB search
MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIRDSAIAMGL
VETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQ
NDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANF
DLWEEVYGHHFFTAMAQQKALTDGAILARQLHDRQAAVFYEMQANLINSRLQQHLDHQNK
IIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHEQFNLMFPI
NKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSLNSSNKLHIQN
YLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIK
TMGWNTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggttcaaata
ttaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctcaccctcg
caatacaatcccaattattattatgactggattcgagactctgccattgccatgggattg
gttgagacatggtatgaagccagccaatctgctcgatataaaaaacttttattagaatac
gtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggatatattg
ggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacgaccacaa
aatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagcttctcgat
cataatgaaatagattatgtcaaatcacatctttataacaacaccatggacccacaatcc
atgggcactatcaagatggatttggaatacatcgcgcatcattggcaagatgcaaatttt
gacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaaaaagcg
ctgaccgatggcgccattttggctcgccaacttcatgacagacaagctgctgttttttat
gaaatgcaagccaacttaattaacagtcgactgcaacagcatttggaccatcagaataaa
ataattcaagccacattattacctcaccctggtcctcaaaaaacactagagcttgattcg
tccgtcatgttgggtattttaactaatccacaaaaagaaggtgtttttgccccacatcac
acctttgtgcgaaatactgcaaaggctttgcatgagcaatttaatttgatgtttcctatt
aataaaaaccgttctggagcaatattgtttggtcgttatcctggcgatacttatgatggc
tatcaaacaaacagcataggaaacccctggtttatcttaacagctacgatggctgaatat
tattttaccatggctcataatctgtccctgaacagcagtaataaacttcatatacagaac
tatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgatctgaat
ttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttgacctgg
agttacgtttccgtcttgcgagctattcatttaagagagcaattggaaaatagaataaaa
actatgggctggaatacctattag

DBGET integrated database retrieval system