KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00846Help
Entry
lpa_00846         CDS       T01232                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
lpa00020  Citrate cycle (TCA cycle)
lpa00190  Oxidative phosphorylation
lpa00650  Butanoate metabolism
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
lpa01130  Biosynthesis of antibiotics
lpa01200  Carbon metabolism
Module
lpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lpa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpa_00846
   00650 Butanoate metabolism
    lpa_00846
  Energy metabolism
   00190 Oxidative phosphorylation
    lpa_00846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADG23869
Position
652258..652605
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKIFQIA
TTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagcttaacaggaaatgggttaaaggattggttaattcaaaga
gttacagctgtctattttgcagcctatttaatttttttatttggatttatattggcaaat
cctgatttaaatttttctcaatggcatcttttgtttgccaataagatatttcaaattgca
acaacaattgggttgatggctttaacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgttatacgtttatcagtacagttattggttgttttatgg
ctccttggtcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system