KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00851Help
Entry
lpa_00851         CDS       T01232                                 

Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpa_00851
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpa_00851
  Amino acid metabolism
   00310 Lysine degradation
    lpa_00851
Enzymes [BR:lpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     lpa_00851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658015..659244
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL
FNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKSTSPVVR
RMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAEVQKESSMRALSFGGREE
KRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVVPVIRDADQLSMAEIE
LAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPI
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagtcaaagtacctgttctacccgagtcagtagctgatgcaacagtggct
gcgtggcataagaaagtgggtgataaagtatctcgcgatgagaacctagttgatctggaa
acagataaagttgtgcttgaagttccatcacctgtggatggggtattgtctgacattctg
tttaataccggagatacggttggttcaggagacttactggcaaaaatttctcaaagtgtt
tccgtagaatctcaaaaaactgagaaagaagagaaacctgtcaaaaaagaagaaataaaa
atttccgaaagtgaatcagttagcacaaaagaagataaatcaaccagtccggtggtaaga
cggatgatggctgaaaatgatttgaaagccgggcagattcaaggtaccggtaaagatggc
aggataaccaaagaagatgttttatcttacatagaatccaatagagaaaaatcaaaccaa
actgctgaagttcaaaaagaatcttctatgagagcactttcttttggtggcagggaagaa
aaacgtgtccctatgacgagactaagagccaagattgcagaacgtttattacaagcacag
cacaatgctgccatgttaaccacttttaacgaagtgaatttaaaggcagttatggatatg
cgttctcagtataaagatagctttgaaaaaaaacatggtgtaaaacttggatttatgtct
ttttttacgaaagcggtagtggagtcgcttaaacgatttccggctgtaaatgcttcaatt
gatggccaagatattgtttatcatggcttctatgatataggaattgctgtttctactgaa
agaggtttagtcgttccggtgattagagacgctgatcagttaagtatggcagaaattgaa
ttagccattaatgacgctgcatcaaaagccagaaccggaaaattatctatggaagagatg
caaggggggacatttaccataactaacggtggagtcttcggttcacttttagctactccc
attatcaacccaccgcaaactggtattttagggatgcataaaattgaggaaagacctatt
gtagagaaagggcaaatagtaatccgtcctatgatgtatgttgctttatcctatgatcat
cgtttaattgatggaaaagattctgtacaatttttagtgagtgttaaagagctgttggaa
gatccatcccgacttttactgaatgtttaa

DBGET integrated database retrieval system