KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00880Help
Entry
lpa_00880         CDS       T01232                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lpa03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(678981..679805)
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETTKQGIKPHLEGRMITAVQVRNRKLRLPVPLNLNELCQGKHITAITRRGKYI
LLHMDKGYLLIHLGMSGHLRIVSQTANPQKHDHIDLHINNGLALRFCDPRRFGLFIYIDE
NPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFL
AKIHPNTSAKKITTEEFNALTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYG
RKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaacaacaaagcaaggtattaaaccccatcttgaaggc
cgtatgattaccgcggtgcaagtgcgtaatcgaaaacttagattaccagtacctctaaac
ctgaatgaattatgccaaggaaagcatataacagctattacccgtagaggaaaatacatc
ttacttcatatggataaaggttatcttctcatccatcttggaatgtccggacatttgcgt
atcgtctcccagacagcaaatcctcaaaaacatgatcatattgatctgcacattaataat
gggcttgctctcagattctgcgatccaagaagatttggcttatttatttacattgatgaa
aatccttaccaacacccactgctggcacatttaggcccggaacctctgtctgatgacttt
aatagcgagtacttattacgtaaagctgcgaataaatcgcaatccatcaagtcatttatt
atggatagtcaaattgttgtcgggataggtaatatttatgcagcagagagtctttttctt
gccaaaatccatccaaatacctctgcaaaaaagataactacagaagaattcaatgctctg
actggtcacatcaaaaagatacttgaatctgccatagaggcaggagggacgacacttcgt
gatttctattcttctgatggtaaaccagggtactttcgttttgctttaaaggtttatggc
aggaaaaatctcccctgtttggtatgtgaaaataaaatagaaactgtcgtgattgccggg
cgccactccgcattttgcccgcattgccagccaatcattacataa

DBGET integrated database retrieval system