KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00998Help
Entry
lpa_00998         CDS       T01232                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpa00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761908..762537
Genome map
AA seq 209 aa AA seqDB search
MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQYGTICSRIGLSEQAY
AFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTD
FRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQAVVEGEQVLIGGNESYV
ATCRLHYKLGEAGKTFPRNKLFNKDTNTF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatatttctactatgcggctatgaatgcaggtaaaagtacggtgttactg
cagtccagttataattacagagaacgcggtatgcaaactctgttgtttaccccagccatc
gatacacgtttccaatatggaactatctgttcacgtatcggtttatccgaacaggcttat
gcttttaacaattcggataacctgtatgttttaactcaagaatttcaactacaaactcag
aaatactcttgtgtcctgattgacgaggctcaatttttaactcgagagcaagtgtatcaa
ttaacggaaataaccgatcaaatgtctattccagtactagcttatgggttacgcactgac
tttagaggcgagttatttccgggaagtcaatttttactggcttgggcagatgagttaatc
gaattaaagacaatttgtcattgtggccgtaaagcaattatgaatatgagaattgatgaa
aatgggcaagctgttgttgagggggagcaggtattgataggcggcaatgaatcctatgtt
gctacctgtcggttgcattataaattaggtgaagcagggaagacgtttccaagaaataaa
ttgttcaataaagataccaatactttttaa

DBGET integrated database retrieval system