KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_00998Help
Entry
lpa_00998         CDS       T01232                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lpa_00998 (tdk)
Enzymes [BR:lpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     lpa_00998 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
761908..762537
Genome map
AA seq 209 aa AA seqDB search
MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQYGTICSRIGLSEQAY
AFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTD
FRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQAVVEGEQVLIGGNESYV
ATCRLHYKLGEAGKTFPRNKLFNKDTNTF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatatttctactatgcggctatgaatgcaggtaaaagtacggtgttactg
cagtccagttataattacagagaacgcggtatgcaaactctgttgtttaccccagccatc
gatacacgtttccaatatggaactatctgttcacgtatcggtttatccgaacaggcttat
gcttttaacaattcggataacctgtatgttttaactcaagaatttcaactacaaactcag
aaatactcttgtgtcctgattgacgaggctcaatttttaactcgagagcaagtgtatcaa
ttaacggaaataaccgatcaaatgtctattccagtactagcttatgggttacgcactgac
tttagaggcgagttatttccgggaagtcaatttttactggcttgggcagatgagttaatc
gaattaaagacaatttgtcattgtggccgtaaagcaattatgaatatgagaattgatgaa
aatgggcaagctgttgttgagggggagcaggtattgataggcggcaatgaatcctatgtt
gctacctgtcggttgcattataaattaggtgaagcagggaagacgtttccaagaaataaa
ttgttcaataaagataccaatactttttaa

DBGET integrated database retrieval system