KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_01266Help
Entry
lpa_01266         CDS       T01232                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpa01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lpa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1006239..1007015)
Genome map
AA seq 258 aa AA seqDB search
MNSILERIAKHKLEEVAVAKKNKPLHVLSKQQPGEIRDFITALKSNTSPAVIAEIKKASP
SKGLIRKDFNVAEIAKIYTQNGARCLSVLTDIEFFQGHPDYLALAKSKTTLPVLRKDFII
DSYQIYESLVLGADCILLIVALLDDVQLMDFCQLAQELKMSVLVESHTQDELERALRLPT
PLIGINNRSLHNFKTDIQLSIQLKQFVPKDKIIITESGINTREDIKLMQSHDINAFLIGE
SLMRADNIGKALQKLMTD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatcttggaacgaatagccaaacataaactagaagaagttgcagttgcaaaa
aaaaataagcctttacatgttctgtcaaaacaacagccgggggaaatacgtgacttcata
actgctttaaaatccaatacctcacctgcagtcatagctgagataaaaaaggcttctcca
agcaaaggtttaattcgaaaagattttaatgttgcagaaattgccaaaatttatacccaa
aatggcgcaagatgcttatccgttttaacggatattgagttttttcaaggtcatcctgat
tatttggctttagcaaaatcaaaaactactttgcccgtattacgtaaagactttattatt
gattcttatcaaatttatgaaagccttgtcttgggcgctgattgcattttactgattgtc
gcattattagatgatgttcaattaatggatttttgccaactggctcaagaacttaaaatg
tctgttttggttgaaagccacacgcaagatgagttagaaagagcattacgcttacccacc
cctcttataggcattaataaccgcagcctacacaactttaaaacagacattcaactgagt
atccaattaaaacaatttgttcctaaagataaaattattattactgaaagcggaatcaac
acccgtgaagacataaaattaatgcaatcccatgacattaatgcctttttgattggagag
agtttaatgagggcagataacatcgggaaagcattacagaaactaatgactgactaa

DBGET integrated database retrieval system