KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_01386Help
Entry
lpa_01386         CDS       T01232                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    lpa_01386 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lpa_01386 (murE)
Enzymes [BR:lpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     lpa_01386 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084584..1086035
Genome map
AA seq 483 aa AA seqDB search
MKLTQLLEPWIKRDIIDGTVSDIKNDSRLVKEGDLFVAYPGAASDGRLYIEKAVASGAVA
VVYEPNNLPQGITLPTAIPCIAIPQLAEKLGEIAKRFFNNPSQFLGLTGVTGTNGKTTIA
YQLAQAHDLLGQHSAYIGTIGQGKVDALKPLENTTPDALCLQRLMHQYKEEGIKQVCMEV
SSHALSQHRVDSLEFSQAIFTNLTLDHLDYHQTMQAYGAAKSRLFERAELQWAIINQDDD
FQDLMSNVLKTHVKKVTYGMHQNCDVKALQWNMDITGTEIEVKSPWGHQLLKIKALGKFN
IYNSLAVYSSLLASGHNPEKVVQVMAELKAAPGRMEIVAQSPYVLVDYAHTPDALENVLI
TLKQIKKGRLWVVFGCGGDRDKTKRPIMGKAASMYADNIVITSDNPRSEDPEIILNEIAC
GIPASAPVSKLVNREEAIAYALRKAEHNDIILIAGKGHESYQQIGNTKHVFSDQEVVRRL
MNN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaacccaattattagaaccgtggattaaaagggacattattgatggcactgtg
agtgacataaaaaatgacagccgcttggtgaaagaaggggatttatttgtcgcctatcca
ggggcagcttccgatggtcgattatatatagaaaaggccgtggcatcaggtgctgtcgct
gtggtttatgagcccaataatttacctcagggaattactttgccaacagcaattccctgt
atagccattccccaattagctgaaaaattaggggaaatagcgaaacggttttttaataac
ccatcccaatttcttggtttaactggggtaactggcacaaatggcaagacgactattgct
tatcagttggcacaggcacatgatttactcgggcagcactcggcttacatcgggactata
ggacaaggcaaggtggatgctttaaaacctttggaaaatactacgccagatgctctttgt
ttgcagaggttgatgcaccagtacaaagaagagggcattaaacaggtttgtatggaggta
tcttctcacgcgttgagccagcatagagtcgactctctcgaatttagtcaggctatcttt
accaatttaacgctcgatcatttagattatcaccaaactatgcaagcttatggggctgcg
aagtcgaggttgtttgaacgagcagagttgcaatgggctattattaatcaggatgacgac
tttcaagatctcatgagcaatgtgctaaagactcatgtaaaaaaagtgacttacggtatg
catcaaaattgcgatgtgaaagcgctccaatggaatatggatatcaccggaacagaaatt
gaagtcaaatctccttgggggcaccagcttctaaagattaaagcactgggtaagtttaat
atttataatagcctggctgtttatagcagtttgcttgccagcgggcataatccagaaaaa
gtagtgcaagttatggccgaattaaaagcggctcctggccgaatggaaattgtcgctcaa
tccccatatgttcttgttgattatgctcatactcccgatgcattggaaaatgttcttatc
accttaaaacaaataaaaaaagggagattgtgggttgtatttggttgtggtggggacaga
gataaaaccaaacggcccattatgggaaaggcagccagcatgtacgctgataatattgtc
attaccagcgataatccgagaagtgaagatccggaaattattctaaatgaaattgcttgt
ggcattcctgcctctgcgcctgtctctaaactggtgaatagagaagaggcaattgcttat
gctttaagaaaggctgaacataacgatattatattaattgcaggaaaaggacatgaatcg
tatcagcagattgggaatacaaaacatgttttttctgatcaggaagttgtaagacgtttg
atgaataattaa

DBGET integrated database retrieval system