KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_01849Help
Entry
lpa_01849         CDS       T01232                                 

Gene name
bglX
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpa00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lpa00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1443380..1444516
Genome map
AA seq 378 aa AA seqDB search
MKIKSIILSFFLVLMATVACATQVSLRDKIGQMLILGFQGKVVDEKSPIAQAIEKNNIGG
VILFDFNQQSQTFDKNIESPEQVNQLNNQLQTLTQKANRKYHRDNLPLLISVDYEGGNVN
RLHPRYGFPEMPSAKDIGSMSLERADASAELMANTLKSTGFNLNFFPELDVNINPDNPII
GKKDRSFSSIPEIVTQYAQLYTEQFIKHQIHCSYKHFPGHGSSLSDSHLGFVDISDTWSE
QELIPFLQLLSQPNHCDMVMIAHIVNRKLDMTGLPASLSYQIINGLLRHDLKFNGVVITD
DMQMKAITNYYGLETAVTLSINAGADMLIFGNQLVEKFQDSTEIIDMIEQKVRSGEISEQ
RINEAYQRIVKMKRSFNY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcaagtcaattattttatctttttttcttgttttgatggctacagtagcttgc
gctacacaagtgagtttgagagataaaattgggcaaatgttaatattaggattccagggc
aaagtggttgacgagaaatcacctattgcccaggcaattgagaaaaacaacattggtggt
gttattctttttgattttaatcagcagtcacaaacttttgataaaaatatagaaagtccg
gaacaagtcaaccaattaaataatcagttacaaacacttacgcaaaaagccaaccgtaaa
tatcatagagataatttaccattacttatttctgttgattacgaggggggaaacgttaat
cgattgcatccccgttatggattccctgaaatgccttcagcaaaagacattggctccatg
tctctggaaagagctgatgcatcagcagaattgatggcaaatactttaaaatcaacagga
tttaatttgaattttttccctgaattagatgtgaatataaatccagataatcctatcata
ggcaaaaaagacaggagtttctcttcgataccggaaattgtcactcaatacgcgcaactt
tatacagagcaatttataaaacatcaaatacattgttcttataaacattttcctggacat
ggcagttcattatctgattcacatttgggttttgtagatataagtgacacctggagcgag
caagaattaatcccttttttacaattattatctcaacccaatcattgcgatatggtgatg
atagctcatattgtgaatagaaaactggatatgacagggctacctgccagcctttcttac
cagatcattaacggattattgcgtcatgatttaaaatttaacggggttgttatcaccgat
gatatgcaaatgaaagcaataacgaattattatggattagaaactgctgttactctttca
attaatgcaggagcagatatgctaatatttggtaatcaattggtagaaaaatttcaagac
tcgacagaaatcattgacatgatcgagcaaaaagttcgatcgggagagatttctgaacaa
aggattaatgaagcttatcaacgaattgtaaaaatgaagaggtcttttaattattag

DBGET integrated database retrieval system