KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_01943Help
Entry
lpa_01943         CDS       T01232                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
lpa00260  Glycine, serine and threonine metabolism
lpa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01130  Biosynthesis of antibiotics
lpa01230  Biosynthesis of amino acids
Module
lpa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpa_01943 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpa_01943 (trpB)
Enzymes [BR:lpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpa_01943 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP XdhC_C
Motif
Other DBs
NCBI-ProteinID: ADG24640
Position
1510412..1511611
Genome map
AA seq 399 aa AA seqDB search
MIKKELPDEFGHFGPYGGMFVADTLVSALKQLEHAYTKYRNDQDFLSELHTELKDYVGRP
NPLYHAVHLSKKIGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQH
GVATATVAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSKTLKDALNEALR
DWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKTGRLPDALVACVGGGS
NAIGLFYPFLNDQSVMIYGVEAGGKGIETGEHSASLIAGKPGVLHGNRTYLLCDEYGQVK
DTHSVSAGLDYPGVGPEHAYLKDTGRVIYKAINDSEALDAFRLLTHTEGIIPALESSHAV
AYAIQLAKTMSKEQSIIVNLSGRGDKDMHTVAAIDGITI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagagcttccagatgagtttggccattttggcccatatggcggtatgttt
gtagccgatacattagtttctgctttaaaacaattagagcatgcctataccaaatatcgt
aacgatcaggattttctgtctgagttacacacagaattaaaagattatgtggggcggccc
aatcctctataccatgccgtacacttaagtaaaaagataggcggtgcacaaatttatctc
aagcgtgaagatttaaatcataccggcgctcataaaatcaataataccattggacaagcc
ttactcgccaaacgcatggggaaaactcgagtgatcgcggaaacaggcgcaggtcaacat
ggcgttgcaactgctacagttgccgctaaatttgggtttcaatgcgttgtgtacatgggg
tcagaagacattaagcgtcaatccagtaatgtttatagaatgaaattgttaggcgctgaa
gtggtgcctgtcacttcaggatcaaagacgttgaaagatgctttaaatgaagcattgaga
gattgggtgagtcatgtcgacgacacgttttatattattggtactgttgcaggtccccat
ccttatcctcaaatggtaagagattttcaagcgattattggtgttgaagctcgagctcag
catatggaaaaaacaggccgtttgccagatgctttggtagcttgtgtcggaggtggatcc
aatgcaataggcttgttttatccctttttgaatgatcagtctgtcatgatttatggggtt
gaagcaggagggaaaggcatagaaaccggtgagcattcagcatctctgattgctggaaaa
cctggtgtgttacacggtaatagaacctatttattgtgtgatgagtatggacaggtgaaa
gacactcattcagtatcagccggtctggattatcctggagttgggcctgaacatgcttat
ttaaaagatactggacgggtcatttataaagcaataaacgattccgaggccctggatgcc
tttcgcctgttaactcatacggaaggaattattccagcattagaatctagccacgcggta
gcctatgccatacaattggctaaaacgatgtcaaaagaacagagcatcatagtcaatcta
tctggccgtggtgataaagatatgcatacagtagctgctattgacggtataacaatttaa

DBGET integrated database retrieval system