KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02077Help
Entry
lpa_02077         CDS       T01232                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    lpa_02077 (glpK)
Enzymes [BR:lpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     lpa_02077 (glpK)
Exosome [BR:lpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpa_02077 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1623783..1625258
Genome map
AA seq 491 aa AA seqDB search
MNYILAIDQGTSSTRAMIYTLQGDLIANSQYPLTQYYPNLGWVEHDPEEIWQKTLNAMRD
VVSQVQGKAILCCGLTNQRETTLIWNKKTGECLAPAIVWQDRRTEEFCYSLSEYSSMIQE
KTGLLPDPYFSASKLNWLLKNNAQAQSLINQGDLAFGTIDSFLIWRMTKGASHATDITNA
SRTMLFNIHDEKWDKQLLELFSISESVLPEVYSSDNHFGVIDKEWLGVEIPITGVAGDQQ
AALIGQSCFNGGMVKATFGTGGFLLLNTGDKPVFSKHKLLTTIAYKIKEKTAYGLEGSIY
HAGTTVKWLRDEMKLISHSAETEVLAQSLDSNNGVYLVSSFTGLGAPHWLSITGTAIIGV
SRSTNRAHFARAALEGVCYQTRDVLTCMRDDSQLDLTLLRADGGMAVNQWFLQFMADQCQ
LTIQKPKDIETTAKGAAVLAAIGSGLFDSVSSVNKVWEVENEFQPSREREVVEKDFRGWL
EALAMVKARHA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatactagctattgaccagggaacaagtagtactcgcgctatgatctacacc
cttcaaggtgatttaattgcaaatagtcagtatccgcttactcaatattaccccaatttg
ggttgggtagaacacgatcctgaggaaatatggcaaaaaactctgaatgcgatgagggat
gtcgtatctcaagttcaaggaaaagcaattttatgctgtggccttaccaaccaacgggaa
actactctgatttggaacaaaaaaacaggggaatgcctcgcgccagctattgtgtggcaa
gatagacgtacggaagagttttgttattcattgtctgaatactcgtcaatgatacaagag
aaaaccggattacttcctgatccctatttttcagcgagcaagttaaactggttactaaag
aataatgctcaagctcaatcactaattaatcagggggatttggcatttgggacaatagac
agttttttaatatggcgcatgactaaaggtgccagtcatgctaccgatatcactaacgca
tccagaactatgctgtttaatattcatgatgaaaaatgggataagcagttgctggagctt
ttttctatttcagaatcggtattaccagaggtttactccagtgataatcattttggggtg
atagataaagaatggctgggagtagaaataccaattaccggggttgcaggtgatcaacaa
gccgctttaattgggcaaagttgttttaatggcggaatggttaaagctacttttggtacg
gggggatttttattgctcaatacaggtgataaaccagttttctcaaaacataaattgttg
actactattgcctataaaattaaagaaaaaacagcttatggtttggagggtagtatttat
catgccggaacaactgttaaatggttacgcgatgaaatgaagttgatatctcattctgct
gaaactgaagtattggcacaaagtcttgatagcaataacggtgtatatcttgtttcatct
tttactggtcttggagcacctcattggttatcaataacaggaacggctattattggcgta
tcccgttcaacgaatagagcgcattttgccagagccgccctggaaggcgtttgttatcaa
acacgtgatgtattaacctgtatgagagatgatagtcaattggatttgactttattaaga
gcggatggagggatggcagtaaaccaatggtttctacaatttatggctgatcagtgtcag
ttgacaattcaaaaacccaaggacattgaaacgactgccaaaggggcagcagtattagcc
gcaataggttctggtctatttgattcagtttcttcagtaaataaggtatgggaagttgag
aacgagtttcagccatccagggaaagagaggtagttgaaaaagattttcgtggctggttg
gaggcgttggcaatggttaaagcaaggcatgcatag

DBGET integrated database retrieval system